SAXSdb — 2z5c

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein YPL144W

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Uncharacterized protein YLR021W × 1 （Q07951） Proteasome component PUP2 × 1 （P32379）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Uncharacterized protein YLR021W × 1 （Q07951） Proteasome component PUP2 × 1 （P32379）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YP144_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–151； UniProt 1–148 Author chain D； PDBConstruct 4–151； UniProt 1–148

Uncharacterized protein YLR021W

Saccharomyces cerevisiae

UniProt Q07951

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Protein YPL144W × 1 （Q12245） Proteasome component PUP2 × 1 （P32379）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Protein YPL144W × 1 （Q12245） Proteasome component PUP2 × 1 （P32379）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YL021_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–60； UniProt 1–60 Author chain B； PDBConstruct 61–149； UniProt 91–179 Author chain E； PDBConstruct 1–60； UniProt 1–60 Author chain E； PDBConstruct 61–149； UniProt 91–179

Proteasome component PUP2

Saccharomyces cerevisiae

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Protein YPL144W × 1 （Q12245） Uncharacterized protein YLR021W × 1 （Q07951）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Protein YPL144W × 1 （Q12245） Uncharacterized protein YLR021W × 1 （Q07951）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 3–262； UniProt 1–260 Author chain F； PDBConstruct 3–262； UniProt 1–260

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2z5c
Deposition date deposition_date	2007-07-03
Structure title title	Crystal Structure of a Novel Chaperone Complex for Yeast 20S Proteasome Assembly
Keywords keywords	PROTEASOME, Chaperone, S. cerevisiae, CHAPERONE-HYDROLASE COMPLEX; CHAPERONE/HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2z5c__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2z5c__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2z5c__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.29 Å
Rg (electron density)	24.71 Å
Total Rg	25.47 Å
Atom count	3299
Residues	419
Excluded volume	59256 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2z5c__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2z5c__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Protein YPL144W
Molecular weight formula_weight	16876.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	6598

GSHMLVKTISRTIESESGFLQPTLDVIATLPADDRSKKIPISLVVGFKQEASLNSSSSLSCYYYAIPLMRDRHINLKSGGSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELGE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Uncharacterized protein YLR021W
Molecular weight formula_weight	16820.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E

MISYEFQTHLPKGKDSSLNASSENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLNHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEVSGTMAQDNMQFSLLISMSSKIWRATKEQSADDNDFGKLVFVLKCIKDMYAK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Proteasome component PUP2
Molecular weight formula_weight	28793.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F

GSMFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	2z5cA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	2z5cB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	2z5cC00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	2z5cD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	2z5cE00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	2z5cF00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

▶

Unit-cell length a length_a	158.687 Å
Unit-cell length b length_b	159.181 Å
Unit-cell length c length_c	65.035 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	50.380 Å
R factor r_factor	0.2513
R_work r_work	0.2496
R_free r_free	0.2833

Crystal Structure of a Novel Chaperone Complex for Yeast 20S Proteasome Assembly

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein YPL144W

State in the Current Structure

Other States of the Same Protein in the Database

Uncharacterized protein YLR021W

State in the Current Structure

Other States of the Same Protein in the Database

Proteasome component PUP2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2z5c__assembly_1__model_1

2z5c__assembly_1__model_1 | I(q)

2z5c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Crystal Structure of a Novel Chaperone Complex for Yeast 20S Proteasome Assembly

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein YPL144W

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein YLR021W

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome component PUP2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2z5c__assembly_1__model_1

2z5c__assembly_1__model_1 | I(q)

2z5c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)