SAXSdb — 2zah

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 180	CALCIUM ION × 240 UNKNOWN ATOM OR ION × 60 water × 180	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	CALCIUM ION × 4 UNKNOWN ATOM OR ION × 1 water × 3	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 15	CALCIUM ION × 20 UNKNOWN ATOM OR ION × 5 water × 15	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 18	CALCIUM ION × 24 UNKNOWN ATOM OR ION × 6 water × 18	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 3	CALCIUM ION × 4 UNKNOWN ATOM OR ION × 1 water × 3	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 15	CALCIUM ION × 20 UNKNOWN ATOM OR ION × 5 water × 15	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3LHM1_MNSV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–331； UniProt 60–390 Author chain B； PDBConstruct 1–331； UniProt 60–390 Author chain C； PDBConstruct 1–331； UniProt 60–390

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2zah
Deposition date deposition_date	2007-10-05
Structure title title	X-ray structure of Melon necrotic spot virus
Keywords keywords	plant virus, coat protein, b-annulus, tombusvirus, carmovirus, fungal vector, MNSV, Capsid protein, ICOSAHEDRAL VIRUS, VIRUS; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2zah__assembly_1__model_1`	180-meric （180）	Excluded	—	—
	Exclusion reason： The source record does not identify the atom or ion element unambiguously, so a reliable calculation is not possible.
2	1	`2zah__assembly_2__model_1`	trimeric （3）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`2zah__assembly_3__model_1`	pentadecameric （15）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`2zah__assembly_4__model_1`	octadecameric （18）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`2zah__assembly_5__model_1`	trimeric （3）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`2zah__assembly_6__model_1`	pentadecameric （15）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Coat protein
Molecular weight formula_weight	35783.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	7095

NISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFIASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGSTIKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVTSSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	UNKNOWN ATOM OR ION
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	39

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	2zahA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2zahA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4030 —

Domain ID domain_id	2zahB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2zahB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4030 —

Domain ID domain_id	2zahC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2zahC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4030 —

▶

Unit-cell length a length_a	375.004 Å
Unit-cell length b length_b	375.004 Å
Unit-cell length c length_c	375.004 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	360

Space group space_group	I 2 3
Space-group number int_tables_number	197
Crystal system crystal_system	—

Resolution resolution	2.810 Å
Low-resolution limit resolution_low	187.500 Å
R factor r_factor	0.2092
R_work r_work	0.2084
R_free r_free	0.2237

X-ray structure of Melon necrotic spot virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

X-ray structure of Melon necrotic spot virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)