SAXSdb — 2zvw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proliferating cell nuclear antigen 2

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Cyclin-dependent kinase inhibitor 1 × 3 （P38936） SULFATE ION × 3 water × 5	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Cyclin-dependent kinase inhibitor 1 × 3 （P38936） SULFATE ION × 3 water × 5	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Cyclin-dependent kinase inhibitor 1 × 3 （P38936） water × 6	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 6	Cyclin-dependent kinase inhibitor 1 × 3 （P38936） SULFATE ION × 3 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCNA2_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 21–275； UniProt 1–255 Author chain B； PDBConstruct 21–275； UniProt 1–255 Author chain C； PDBConstruct 21–275； UniProt 1–255 Author chain D； PDBConstruct 21–275； UniProt 1–255 Author chain E； PDBConstruct 21–275； UniProt 1–255 Author chain F； PDBConstruct 21–275； UniProt 1–255 Author chain G； PDBConstruct 21–275； UniProt 1–255 Author chain H； PDBConstruct 21–275； UniProt 1–255

Cyclin-dependent kinase inhibitor 1

OrganismNot specified

UniProt P38936

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Proliferating cell nuclear antigen 2 × 3 （Q9ZW35） SULFATE ION × 3 water × 5	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Proliferating cell nuclear antigen 2 × 3 （Q9ZW35） SULFATE ION × 3 water × 5	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Proliferating cell nuclear antigen 2 × 3 （Q9ZW35） water × 6	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 6	Proliferating cell nuclear antigen 2 × 3 （Q9ZW35） SULFATE ION × 3 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDN1A_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–22； UniProt 139–160 Author chain J； PDBConstruct 1–22； UniProt 139–160 Author chain K； PDBConstruct 1–22； UniProt 139–160 Author chain L； PDBConstruct 1–22； UniProt 139–160 Author chain M； PDBConstruct 1–22； UniProt 139–160 Author chain N； PDBConstruct 1–22； UniProt 139–160 Author chain O； PDBConstruct 1–22； UniProt 139–160 Author chain P； PDBConstruct 1–22； UniProt 139–160

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2zvw
Deposition date deposition_date	2008-11-21
Structure title title	Crystal structure of Proliferating cell nuclear antigen 2 and Short peptide from human P21
Keywords keywords	protein-peptide complex, DNA replication, DNA-binding, Nucleus, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2zvw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2zvw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2zvw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.42 Å
Rg (electron density)	32.23 Å
Total Rg	32.90 Å
Atom count	6162
Residues	798
Excluded volume	110170 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2zvw__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2zvw__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2zvw__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2zvw__assembly_4__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Proliferating cell nuclear antigen 2
Molecular weight formula_weight	30334.6 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	16590

MGSSHHHHHHSSGLVPRGSHMLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSGEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMNEPVSLSFALRYMNSFTKATPLSETVTISLSSELPVVVEYKVAEMGYIRYYLAPKI

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	Mouse-ear cress,thale-cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Cyclin-dependent kinase inhibitor 1
Molecular weight formula_weight	2779.2 kDa
Source method src_method	syn
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L,M,N,O,P

GRKRRQTSMTDFYHSKRRLIFS

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	163

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	2zvwA00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2zvwB00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2zvwC00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2zvwD00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2zvwE00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2zvwF00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2zvwG00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2zvwH00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	223.693 Å
Unit-cell length b length_b	223.693 Å
Unit-cell length c length_c	200.876 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	72

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	36.690 Å
R factor r_factor	0.2340
R_work r_work	0.2340
R_free r_free	0.2610

Crystal structure of Proliferating cell nuclear antigen 2 and Short peptide from human P21

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proliferating cell nuclear antigen 2

State in the Current Structure

Other States of the Same Protein in the Database

Cyclin-dependent kinase inhibitor 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zvw__assembly_1__model_1

2zvw__assembly_1__model_1 | I(q)

2zvw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Crystal structure of Proliferating cell nuclear antigen 2 and Short peptide from human P21

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proliferating cell nuclear antigen 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cyclin-dependent kinase inhibitor 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zvw__assembly_1__model_1

2zvw__assembly_1__model_1 | I(q)

2zvw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)