3cd6

Co-cystal of large Ribosomal Subunit mutant G2616A with CC-Puromycin

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L2P

OrganismNot specified

UniProt P20276

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_HALMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–240； UniProt 1–240

50S ribosomal protein L3P

OrganismNot specified

UniProt P20279

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_HALMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–338； UniProt 1–338

50S ribosomal protein L4P

OrganismNot specified

UniProt P12735

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_HALMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–246； UniProt 1–246

50S ribosomal protein L5P

OrganismNot specified

UniProt P14124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_HALMA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–177； UniProt 1–177

50S ribosomal protein L6P

OrganismNot specified

UniProt P14135

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_HALMA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–178； UniProt 1–178

50S ribosomal protein L7Ae

OrganismNot specified

UniProt P12743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_HALMA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–120； UniProt 1–120

50S ribosomal protein L10E

OrganismNot specified

UniProt P15825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RLA0_HALMA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–348； UniProt 1–348

50S ribosomal protein L10e

OrganismNot specified

UniProt P60617

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10_HALMA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–177； UniProt 1–177

50S ribosomal protein L11P

OrganismNot specified

UniProt P14122

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL11_HALMA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–162； UniProt 1–162

50S ribosomal protein L13P

OrganismNot specified

UniProt P29198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_HALMA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–145； UniProt 1–145

50S ribosomal protein L14P

OrganismNot specified

UniProt P22450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_HALMA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–132； UniProt 1–132

50S ribosomal protein L15P

OrganismNot specified

UniProt P12737

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_HALMA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–165； UniProt 1–165

50S ribosomal protein L15e

OrganismNot specified

UniProt P60618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15E_HALMA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–196； UniProt 1–196

50S ribosomal protein L18P

OrganismNot specified

UniProt P14123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_HALMA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–187； UniProt 1–187

50S ribosomal protein L18e

OrganismNot specified

UniProt P12733

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_HALMA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–116； UniProt 1–116

50S ribosomal protein L19e

OrganismNot specified

UniProt P14119

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL19_HALMA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain P； PDBConstruct 1–149； UniProt 1–149

50S ribosomal protein L21e

OrganismNot specified

UniProt P12734

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_HALMA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Q； PDBConstruct 1–96； UniProt 1–96

50S ribosomal protein L22P

OrganismNot specified

UniProt P10970

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_HALMA
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain R； PDBConstruct 1–155； UniProt 1–155

50S ribosomal protein L23P

OrganismNot specified

UniProt P12732

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_HALMA
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain S； PDBConstruct 1–85； UniProt 1–85

50S ribosomal protein L24P

OrganismNot specified

UniProt P10972

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_HALMA
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain T； PDBConstruct 1–120； UniProt 1–120

50S ribosomal protein L24e

OrganismNot specified

UniProt P14116

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_HALMA
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain U； PDBConstruct 1–67； UniProt 1–67

50S ribosomal protein L29P

OrganismNot specified

UniProt P10971

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_HALMA
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain V； PDBConstruct 1–71； UniProt 1–71

50S ribosomal protein L30P

OrganismNot specified

UniProt P14121

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_HALMA
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain W； PDBConstruct 1–154； UniProt 1–154

50S ribosomal protein L31e

OrganismNot specified

UniProt P18138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_HALMA
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain X； PDBConstruct 1–92； UniProt 1–92

50S ribosomal protein L32e

OrganismNot specified

UniProt P12736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL32_HALMA
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Y； PDBConstruct 1–241； UniProt 1–241

50S ribosomal protein L37e

OrganismNot specified

UniProt P32410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_HALMA
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 1； PDBConstruct 1–57； UniProt 1–57

50S ribosomal protein L39e

OrganismNot specified

UniProt P22452

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L44E × 1 （P32411） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_HALMA
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 2； PDBConstruct 1–50； UniProt 1–50

50S ribosomal protein L44E

OrganismNot specified

UniProt P32411

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 29 RNA 3	50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 ;RNA (5'-R(CPCP*(PPU))-3') ; × 1 MAGNESIUM ION × 93 CHLORIDE ION × 22 STRONTIUM ION × 107 SODIUM ION × 75 CADMIUM ION × 5 POTASSIUM ION × 2 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL44_HALMA
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 3； PDBConstruct 1–92； UniProt 1–92

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3cd6
Deposition date deposition_date	2008-02-26
Structure title title	Co-cystal of large Ribosomal Subunit mutant G2616A with CC-Puromycin
Keywords keywords	G2616A mutation, 23S rRNA, large ribosomal subunit, CC-Puromycin, RIBOSOME; RIBOSOME
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3cd6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3cd6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3cd6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.73 Å
Rg (electron density)	69.65 Å
Total Rg	69.43 Å
Atom count	91371
Residues	6648
Excluded volume	1396500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3cd6__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (39)

Entity 1 Entity 1 polymer

Description description	50S ribosomal protein L2P
Molecular weight formula_weight	25354.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	99180

MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

Entity 2 Entity 2 polymer

Description description	50S ribosomal protein L3P
Molecular weight formula_weight	37396.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG

Entity 3 Entity 3 polymer

Description description	50S ribosomal protein L4P
Molecular weight formula_weight	26457.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER

Entity 4 Entity 4 polymer

Description description	50S ribosomal protein L5P
Molecular weight formula_weight	19551.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEVSE

Entity 5 Entity 5 polymer

Description description	50S ribosomal protein L6P
Molecular weight formula_weight	19961.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKPNRGDA

Entity 6 Entity 6 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	12791.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR

Entity 7 Entity 7 polymer

Description description	50S ribosomal protein L10E
Molecular weight formula_weight	37169.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLSDSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATTAPTMLQSARGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDDADADDAAEEADDDDDDDEDAGDALGAMF

Entity 8 Entity 8 polymer

Description description	50S ribosomal protein L10e
Molecular weight formula_weight	19942.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEELLIA

Entity 9 Entity 9 polymer

Description description	50S ribosomal protein L11P
Molecular weight formula_weight	17097.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA

Entity 10 Entity 10 polymer

Description description	50S ribosomal protein L13P
Molecular weight formula_weight	16249.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW

Entity 11 Entity 11 polymer

Description description	50S ribosomal protein L14P
Molecular weight formula_weight	14216.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV

Entity 12 Entity 12 polymer

Description description	50S ribosomal protein L15P
Molecular weight formula_weight	18005.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE

Entity 13 Entity 13 polymer

Description description	50S ribosomal protein L15e
Molecular weight formula_weight	22404.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK

Entity 14 Entity 14 polymer

Description description	50S ribosomal protein L18P
Molecular weight formula_weight	20640.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL

Entity 15 Entity 15 polymer

Description description	50S ribosomal protein L18e
Molecular weight formula_weight	12438.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR

Entity 16 Entity 16 polymer

Description description	50S ribosomal protein L19e
Molecular weight formula_weight	16796.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA

Entity 17 Entity 17 polymer

Description description	50S ribosomal protein L21e
Molecular weight formula_weight	10567.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE

Entity 18 Entity 18 polymer

Description description	50S ribosomal protein L22P
Molecular weight formula_weight	16966.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED

Entity 19 Entity 19 polymer

Description description	50S ribosomal protein L23P
Molecular weight formula_weight	9612.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRIGVF

Entity 20 Entity 20 polymer

Description description	50S ribosomal protein L24P
Molecular weight formula_weight	13671.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA

Entity 21 Entity 21 polymer

Description description	50S ribosomal protein L24e
Molecular weight formula_weight	7364.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MPRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA

Entity 22 Entity 22 polymer

Description description	50S ribosomal protein L29P
Molecular weight formula_weight	7889.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE

Entity 23 Entity 23 polymer

Description description	50S ribosomal protein L30P
Molecular weight formula_weight	17062.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR

Entity 24 Entity 24 polymer

Description description	50S ribosomal protein L31e
Molecular weight formula_weight	10384.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAETAE

Entity 25 Entity 25 polymer

Description description	50S ribosomal protein L32e
Molecular weight formula_weight	26455.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEVEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

Entity 26 Entity 26 polymer

Description description	50S ribosomal protein L37Ae
Molecular weight formula_weight	12900.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSPRARREPNLEGLMWPLGGQQTTMASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSEDEE

Entity 27 Entity 27 polymer

Description description	50S ribosomal protein L37e
Molecular weight formula_weight	6330.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE

Entity 28 Entity 28 polymer

Description description	50S ribosomal protein L39e
Molecular weight formula_weight	6133.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE

Entity 29 Entity 29 polymer

Description description	50S ribosomal protein L44E
Molecular weight formula_weight	10815.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE

Entity 30 Entity 30 polymer

Description description	23S RIBOSOMAL RNA
Molecular weight formula_weight	946431.5 kDa
Mutation mutation	G2099A, G2616A
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	0

GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAGGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUAGGUUUAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU

Entity 31 Entity 31 polymer

Description description	5S RIBOSOMAL RNA
Molecular weight formula_weight	39303.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	9

UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC

Entity 32 Entity 32 polymer

Description description	;RNA (5'-R(CPCP*(PPU))-3') ;
Molecular weight formula_weight	1098.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

CCA

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	93

Entity 34 Entity 34 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 35 Entity 35 non-polymer

Description description	STRONTIUM ION
Molecular weight formula_weight	87.6 kDa
Source method src_method	syn
Copy count entity_count	107

Entity 36 Entity 36 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	75

Entity 37 Entity 37 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 38 Entity 38 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 39 Entity 39 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	7809

▼

6. Fold Classification (SCOP + CATH) 60 domains

SCOP 2.08 (24 domains)

Domain ID domain_id	d3cd611
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd621
Class class	a — All alpha proteins
Fold Fold fold	a.137 — Non-globular all-alpha subunits of globular proteins
Superfamily Superfamily superfamily	a.137.1 — Ribosomal protein L39e
Family Family family	a.137.1.1 — Ribosomal protein L39e

Domain ID domain_id	d3cd631
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6b1
Class class	b — All beta proteins
Fold Fold fold	b.43 — Reductase/isomerase/elongation factor common domain
Superfamily Superfamily superfamily	b.43.3 — Translation proteins
Family Family family	b.43.3.2 — Ribosomal protein L3

Domain ID domain_id	d3cd6d1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6f1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.3 — L30e-like
Family Family family	d.79.3.1 — L30e/L7ae ribosomal proteins

Domain ID domain_id	d3cd6h1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.41 — alpha/beta-Hammerhead
Superfamily Superfamily superfamily	d.41.4 — Ribosomal protein L16p/L10e
Family Family family	d.41.4.1 — Ribosomal protein L10e

Domain ID domain_id	d3cd6i1
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.7 — Ribosomal protein L11, C-terminal domain
Family Family family	a.4.7.1 — Ribosomal protein L11, C-terminal domain

Domain ID domain_id	d3cd6j1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6k1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6l1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6n1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6o1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6p1
Class class	a — All alpha proteins
Fold Fold fold	a.94 — Ribosomal protein L19 (L19e)
Superfamily Superfamily superfamily	a.94.1 — Ribosomal protein L19 (L19e)
Family Family family	a.94.1.1 — Ribosomal protein L19 (L19e)

Domain ID domain_id	d3cd6q1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6r1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.55 — Ribosomal protein L22
Superfamily Superfamily superfamily	d.55.1 — Ribosomal protein L22
Family Family family	d.55.1.1 — Ribosomal protein L22

Domain ID domain_id	d3cd6s1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.12 — Ribosomal proteins S24e, L23 and L15e
Superfamily Superfamily superfamily	d.12.1 — Ribosomal proteins S24e, L23 and L15e
Family Family family	d.12.1.1 — L23p

Domain ID domain_id	d3cd6t1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6u1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6v1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6w1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6x1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.2 — Large subunit

Domain ID domain_id	d3cd6y1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.9 — Barstar-like
Superfamily Superfamily superfamily	c.9.2 — Ribosomal protein L32e
Family Family family	c.9.2.1 — Ribosomal protein L32e

Domain ID domain_id	d3cd6z1
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.8 — Zn-binding ribosomal proteins
Family Family family	g.41.8.1 — Ribosomal protein L37ae

CATH v4.4 (36 domains)

Domain ID domain_id	3cd6100
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3cd6200
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1620 — Atp Synthase Epsilon Chain; Chain: I;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L39

Domain ID domain_id	3cd6300
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	450 — Nuclear Transport Factor 2; Chain: A,
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	3cd6A01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	3cd6A02
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3cd6A03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	950 — Ribosomal protein L2; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L2, domain 3

Domain ID domain_id	3cd6B01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	960 — Ribosomal protein L3; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L3, domain 3

Domain ID domain_id	3cd6B02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	10 — Translation factors

Domain ID domain_id	3cd6B03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1430 — Ribosomal Protein L3; Chain: B; domain 2,
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cd6C00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1370 — Ribosomal Protein L4; Chain: A;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L4/L1

Domain ID domain_id	3cd6D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1440 — 50s Ribosomal Protein L5; Chain: A,
Homologous superfamily homologous superfamily	10 — Ribosomal protein L5

Domain ID domain_id	3cd6E01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	930 — Outer Surface Protein A; domain 3
Homologous superfamily homologous superfamily	12 — Ribosomal protein L6

Domain ID domain_id	3cd6E02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	930 — Outer Surface Protein A; domain 3
Homologous superfamily homologous superfamily	12 — Ribosomal protein L6

Domain ID domain_id	3cd6F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/S12

Domain ID domain_id	3cd6H00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1170 — Aldehyde Oxidoreductase; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L16/L10

Domain ID domain_id	3cd6I00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	250 — Ribosomal protein L11/L12, C-terminal domain

Domain ID domain_id	3cd6J00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1180 — Ribosomal Protein L13p; Chain: A;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L13

Domain ID domain_id	3cd6K00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	150 — Ribosomal Protein L14
Homologous superfamily homologous superfamily	20 — Ribosomal protein L14/L23

Domain ID domain_id	3cd6L01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	990 — Molecule: Ribosomal Protein L15; Chain: K; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cd6L02
Class class	3 — Alpha Beta
Architecture architecture	100 — Ribosomal Protein L15; Chain: K; domain 2
Topology topology	10 — Ribosomal Protein L15; Chain: K; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cd6M00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1120 — Ribosomal protein L15e
Homologous superfamily homologous superfamily	10 — Ribosomal protein L15

Domain ID domain_id	3cd6N00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3cd6O00
Class class	3 — Alpha Beta
Architecture architecture	100 — Ribosomal Protein L15; Chain: K; domain 2
Topology topology	10 — Ribosomal Protein L15; Chain: K; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cd6P01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1650 — 50s Ribosomal Protein L19e, Chain O, domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cd6P02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	560 — Single Heli x bin

Domain ID domain_id	3cd6P03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1200 — Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
Homologous superfamily homologous superfamily	60 —

Domain ID domain_id	3cd6Q00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	70 — Ribosomal protein L21

Domain ID domain_id	3cd6R00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	470 — Ribosomal Protein L22; Chain A
Homologous superfamily homologous superfamily	10 — Ribosomal protein L22/L17

Domain ID domain_id	3cd6S00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	3cd6T00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3cd6U00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	170 — Ribosomal Protein L24e; Chain: T;
Homologous superfamily homologous superfamily	20 — Ribosomal protein L24

Domain ID domain_id	3cd6V00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	310 —

Domain ID domain_id	3cd6W01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1390 — Ribosomal Protein L30; Chain: A,
Homologous superfamily homologous superfamily	20 — Ribosomal protein L30/L7

Domain ID domain_id	3cd6W02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	15 — 3-methyladenine DNA Glycosylase II; Chain A, domain 3
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/L7, central domain

Domain ID domain_id	3cd6X00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	440 — Ribosomal Protein L31e; Chain: W;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L31

Domain ID domain_id	3cd6Z00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	212.805 Å
Unit-cell length b length_b	299.997 Å
Unit-cell length c length_c	576.002 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	49.950 Å
R factor r_factor	0.1930
R_work r_work	0.1930
R_free r_free	0.2410

Co-cystal of large Ribosomal Subunit mutant G2616A with CC-Puromycin

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L2P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L3P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L4P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L5P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L6P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L7Ae

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L10E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L10e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L11P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L13P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer