SAXSdb — 3chn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ig alpha-1 chain C region

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Immunoglobulin kappa light chain × 4 Secretory component × 1 （P01833） Secretory component × 1 （P01833）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IGHA1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 123–475； UniProt 1–353 Author chain B； PDBConstruct 123–475； UniProt 1–353 Author chain C； PDBConstruct 123–475； UniProt 1–353 Author chain D； PDBConstruct 123–475； UniProt 1–353

Secretory component

OrganismNot specified

UniProt P01833

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Immunoglobulin kappa light chain × 4 Ig alpha-1 chain C region × 4 （P01876）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIGR_HUMAN
Isoform	—
PDB entities	3, 4
Chains and sequence ranges	Author chain J； PDBConstruct 1–106； UniProt 353–458 Author chain S； PDBConstruct 1–585； UniProt 19–603

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3chn
Deposition date deposition_date	2008-03-10
Structure title title	Solution structure of human secretory IgA1
Keywords keywords	;Immunoglobulin A, Secretory immunoglobulin A, Mucosal immunity, neutron scattering, X-ray scattering, Chromophore, Glycoprotein, Immunoglobulin C region, Immunoglobulin domain, Membrane, Phosphoprotein, Secreted, Transmembrane, IMMUNE SYSTEM ;; IMMUNE SYSTEM
Experimental Method method	SOLUTION SCATTERING

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3chn__assembly_1__model_6

Assembly 1 · Model 6 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3chn__assembly_1__model_6 | I(q)

100 plotted points; both axes use logarithmic scales.

3chn__assembly_1__model_6 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	91.09 Å
Rg (electron density)	91.67 Å
Total Rg	91.31 Å
Atom count	0
Residues	0
Excluded volume	452660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3chn__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`3chn__assembly_1__model_2`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`3chn__assembly_1__model_3`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`3chn__assembly_1__model_4`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`3chn__assembly_1__model_5`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`3chn__assembly_1__model_6`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`3chn__assembly_1__model_7`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`3chn__assembly_1__model_8`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`3chn__assembly_1__model_9`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`3chn__assembly_1__model_10`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Immunoglobulin kappa light chain
Molecular weight formula_weight	23216.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,N,O
Atom count atom_count	34470

ELVMTQSPSSLSASVGDRVNIACRASQGISSALAWYQQKPGKAPRLLIYDASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFAIYYCQQFNSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Entity 2 Entity 2 polymer

Description description	Ig alpha-1 chain C region
Molecular weight formula_weight	51068.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,C

QVKLLEQSGAEVKKPGASVKVSCKASGYSFTSYGLHWVRQAPGQRLEWMGWISAGTGNTKYSQKFRGRVTFTRDTSATTAYMGLSSLRPEDTAVYYCARDPYGGGKSEFDYWGQGTLVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

Entity 3 Entity 3 polymer

Description description	Secretory component
Molecular weight formula_weight	11850.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

PRSPTVVKGVAGSSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKII

Entity 4 Entity 4 polymer

Description description	Secretory component
Molecular weight formula_weight	64355.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGSSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Solution structure of human secretory IgA1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ig alpha-1 chain C region

State in the Current Structure

Other States of the Same Protein in the Database

Secretory component

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3chn__assembly_1__model_6

3chn__assembly_1__model_6 | I(q)

3chn__assembly_1__model_6 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (4)

Solution structure of human secretory IgA1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ig alpha-1 chain C region

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Secretory component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3chn__assembly_1__model_6

3chn__assembly_1__model_6 | I(q)

3chn__assembly_1__model_6 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (4)