SAXSdb — 6xja

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunoglobulin A1 protease

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Immunoglobulin heavy constant alpha 1 × 2 （P01876） Immunoglobulin alpha-1 light chain × 1 Immunoglobulin alpha-1 heavy chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IGA1_STRR6
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain P； PDBConstruct 1–1299； UniProt 665–1963

Immunoglobulin heavy constant alpha 1

OrganismNot specified

UniProt P01876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Immunoglobulin A1 protease × 1 （Q59947） Immunoglobulin alpha-1 light chain × 1 Immunoglobulin alpha-1 heavy chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IGHA1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–210； UniProt 122–331 Author chain B； PDBConstruct 1–210； UniProt 122–331

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6xja
Deposition date deposition_date	2020-06-23
Structure title title	Streptococcus Pneumoniae IgA1 Protease with IgA1 substrate
Keywords keywords	IgA1, Complex, Protease, metalloprotease, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6xja__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6xja__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6xja__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.54 Å
Rg (electron density)	50.06 Å
Total Rg	50.14 Å
Atom count	16441
Residues	2156
Excluded volume	290950 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6xja__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Immunoglobulin A1 protease
Molecular weight formula_weight	145926.6 kDa
EC 编号 ec_number	3.4.24.13
Mutation mutation	E1605A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P
Atom count atom_count	16441

GNTTSENGQTEPEKKLELRNVSDIELYSQTNGTYRQHVSLDGIPENTDTYFVKVKSSAFKDVYIPVASITEEKRNGQSVYKITAKAEKLQQELENKYVDNFTFYLDKKAKEENTNFTSFSNLVKAINQNPSGTYHLAASLNANEVELGPDERSYIKDTFTGRLIGEKDGKNYAIYNLKKPLFENLSGATVEKLSLKNVAISGKNDIGSLANEATNGTKIKQVHVDGVLAGERGVGGLLAKADQSSIAESSFKGRIVNTYETTDAYNIGGLVGHLTGKNASIAKSKATVTISSNTNRSDQTVGGLAGLVDQDAHIQNSYAEGDINNVKHFGKVAGVAGYLWDRTSGEEKHAGELTNVLSDVNVTNGNAITGYHYTGMKVANTFSSKANRVFNVTLEKDEVVSKESFEERGTMLDASQIVSKKAEINPLTLPTVEPLSTSGKKDSDFSKIAHYQANRALVYKNIEKLLPFYNKSTIVKYGNLVKENSLLYQKELLSAVMMKDDQVITDIVSNKQTANKLLLHYNDHSSEKFDLKYQTDFANLAEYNLGNTGLLYTPNQFLYDRDSIVKEVLPELQKLDYQSDAIRKTLGISPEVKLTELYLEDQFSKTKQNLGDSLKKLLSADAGLASDNSVTRGYLVDKIKNNKEALLLGLTYLERWYNFNYGQVNVKDLVMYHPDFFGKGNTSPLDTLIELGKSGFNNLLAKNNVDTYGISLASQHGATDLFSTLEHYRKVFLPNTSNNDWFKSETKAYIVEEKSTIEEVKTKQGLAGTKYSIGVYDRITSATWKYRNMVLPLLTLPERSVFVISTMSSLGFGAYDRYRSSDHKAGKALNDFVEENARETAKRQRDHYDYWYRILDEQSREKLYRTILLYDAYKFGDDTTSGKATAEAKFDSSNPAMKNFFGPVGNKVVHNQHGAYATGDGVYYMSYRMLDKDGAITYTHAMTHDSDQDIYLGGYGRRNGLGPEFFAKGLLQAPDQPSDATITINSILKHSKSDSTEGSRLQVLDPTERFQNAADLQNYVHNMFDLIYMMEYLEGQSIVNKLSVYQKMAALRKIENKYVKDPADGNEVYATNVVKELTEAEARNLNSFESLIDHNILSAREYQSGDYERNGYYTIKLFAPIYSALSSEKGTPGDLMGRRIAYELLAAKGFKDGMVPYISNQYEEDAKQQGQTINLYGKERGLVTDELVLKKVFDGKYKTWAEFKTAMYQERVDQFGNLKQVTFKDPTKPWPSYGTKTINNVDELQALMDQAVLKDAEGPRWSNYDPEIDSAVHKLKRAIFKAYLDQTNDFRSSIFENKK

Source Source

Source organism organism	Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
NCBI taxonomy ID ncbi_taxonomy_id	171101
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Immunoglobulin heavy constant alpha 1
Molecular weight formula_weight	22888.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDR

Entity 3 Entity 3 polymer

Description description	Immunoglobulin alpha-1 light chain
Molecular weight formula_weight	21947.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

AAAMAQSPASLSASAGAAAAIACRSSQAAAAAAAAAALAWYAAKPGAAPAALIYAASAAASAVPARFSGSGAGTDFAAAIAAVEAEDAAAYYCAQAAAAAATFGAGTRAEAKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Entity 4 Entity 4 polymer

Description description	Immunoglobulin alpha-1 heavy chain
Molecular weight formula_weight	21930.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AVALAASGAAAAAPGASLKLSCAASGATAAAAAAAWVRAAAGKALEWVAAIAAAAAAAAAAAAAAAAAAAAISADASAAAAALAAASLAAADTAAYYCAAAGAAAAAAWGQGTLVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPAVPTPPTPSPS

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	6xjaH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	6xjaL01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	100000

Streptococcus Pneumoniae IgA1 Protease with IgA1 substrate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunoglobulin A1 protease

State in the Current Structure

Other States of the Same Protein in the Database

Immunoglobulin heavy constant alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6xja__assembly_1__model_1

6xja__assembly_1__model_1 | I(q)

6xja__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Streptococcus Pneumoniae IgA1 Protease with IgA1 substrate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunoglobulin A1 protease

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Immunoglobulin heavy constant alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6xja__assembly_1__model_1

6xja__assembly_1__model_1 | I(q)

6xja__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)