SAXSdb — 3ci0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pseudopilin GspI

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Pseudopilin GspJ × 1 （Q8VRM4） Pseudopilin GspK × 1 （A7ZRI8） CHLORIDE ION × 1 CALCIUM ION × 3 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8VPC3_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain I； PDBConstruct 4–89； UniProt 33–118

Pseudopilin GspJ

Escherichia coli

UniProt Q8VRM4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Pseudopilin GspI × 1 （Q8VPC3） Pseudopilin GspK × 1 （A7ZRI8） CHLORIDE ION × 1 CALCIUM ION × 3 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8VRM4_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 2–163； UniProt 26–187

Pseudopilin GspK

Escherichia coli

UniProt A7ZRI8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Pseudopilin GspI × 1 （Q8VPC3） Pseudopilin GspJ × 1 （Q8VRM4） CHLORIDE ION × 1 CALCIUM ION × 3 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A7ZRI8_ECO24
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 4–298； UniProt 31–325

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ci0
Deposition date deposition_date	2008-03-10
Structure title title	The Crystal Structure of the GspK-GspI-GspJ complex from enterotoxigenic Escherichia coli Type 2 Secretion System
Keywords keywords	GENERAL SECRETORY PATHWAY, PSEUDOPILUS, TYPE 4 PILIN BIOGENESIS, METHYLATION, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3ci0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3ci0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3ci0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.43 Å
Rg (electron density)	24.56 Å
Total Rg	25.27 Å
Atom count	4112
Residues	507
Excluded volume	73273 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3ci0__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Pseudopilin GspI
Molecular weight formula_weight	10101.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I
Atom count atom_count	4302

GAMSNQHVLEEKTVAGWVAENQTALLYLMTRGQRAVRQQGESDMAGSRWYWRTTPLSTGNALLQAVDIEVSLHEDFSSVIQSRRAWFSA

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Pseudopilin GspJ
Molecular weight formula_weight	18686.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MNSAVAGHDQKLNLMQQTMSFLTHDLTQMMPRPVRGDQGQREPALLAGAGVLASESEGMRFVRGGVVNPLMRLPRSNLLTVGYRIHDGYLERLAWPLTDAAGSVKPTMQKLIPADSLRLQFYDGTRWQESWSSVQAIPVAVRMTLHSPQWGEIERIWLLRGPQ

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Pseudopilin GspK
Molecular weight formula_weight	33696.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

GAMGRMQQQLGRTRSQQEYQQALWYSASAESLALSALSLSLKNEKRVHLEQPWASGPRFFPLPQGQIAVTLRDAQACFNLNALAQPTTASRPLAVQQLIALISRLDVPAYRAELIAESLWEFIDEDRSVQTRLGREDSEYLARSVPFYAANQPLADISEMRVVQGMDAGLYQKLKPLVCALPMTRQQININTLDVTQSVILEALFDPWLSPVQARALLQQRPAKGWEDVDQFLAQPLLADVDERTKKQLKTVLSVDSNYFWLRSDITVNEIELTMNSLIVRMGPQHFSVLWHQTGESE

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	190

▼

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d3ci0i1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.24 — Pili subunits
Superfamily Superfamily superfamily	d.24.1 — Pili subunits
Family Family family	d.24.1.7 — GSPII I/J protein-like

Domain ID domain_id	d3ci0j1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.24 — Pili subunits
Superfamily Superfamily superfamily	d.24.1 — Pili subunits
Family Family family	d.24.1.5 — EpsJ-like

Domain ID domain_id	d3ci0k1
Class class	a — All alpha proteins
Fold Fold fold	a.60 — SAM domain-like
Superfamily Superfamily superfamily	a.60.16 — GspK insert domain-like
Family Family family	a.60.16.1 — GspK insert domain-like

Domain ID domain_id	d3ci0k2
Class class	a — All alpha proteins
Fold Fold fold	a.60 — SAM domain-like
Superfamily Superfamily superfamily	a.60.16 — GspK insert domain-like
Family Family family	a.60.16.1 — GspK insert domain-like

Domain ID domain_id	d3ci0k3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.24 — Pili subunits
Superfamily Superfamily superfamily	d.24.1 — Pili subunits
Family Family family	d.24.1.6 — GspK pilin-like domain

CATH v4.4 (6 domains)

Domain ID domain_id	3ci0I00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1300 — Pantoate--beta-alanine Ligase; Chain: A,domain 2
Homologous superfamily homologous superfamily	30 — GSPII I/J protein-like

Domain ID domain_id	3ci0J01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	610 — Pili subunits
Homologous superfamily homologous superfamily	10 — GSPII I/J protein-like

Domain ID domain_id	3ci0J02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	20 — gspk-gspi-gspj complex like domains

Domain ID domain_id	3ci0K01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1300 — Pantoate--beta-alanine Ligase; Chain: A,domain 2
Homologous superfamily homologous superfamily	30 — GSPII I/J protein-like

Domain ID domain_id	3ci0K02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	40 — Ribonucleotide Reductase Protein R1; domain 1
Homologous superfamily homologous superfamily	60 — EpsJ-like

Domain ID domain_id	3ci0K03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	40 — Ribonucleotide Reductase Protein R1; domain 1
Homologous superfamily homologous superfamily	60 — EpsJ-like

▶

Unit-cell length a length_a	96.118 Å
Unit-cell length b length_b	96.118 Å
Unit-cell length c length_c	108.436 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	35.960 Å
R factor r_factor	0.1949
R_work r_work	0.1915
R_free r_free	0.2594

The Crystal Structure of the GspK-GspI-GspJ complex from enterotoxigenic Escherichia coli Type 2 Secretion System

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pseudopilin GspI

State in the Current Structure

Other States of the Same Protein in the Database

Pseudopilin GspJ

State in the Current Structure

Other States of the Same Protein in the Database

Pseudopilin GspK

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ci0__assembly_1__model_1

3ci0__assembly_1__model_1 | I(q)

3ci0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (5 domains)

CATH v4.4 (6 domains)

7. Citations (1)

The Crystal Structure of the GspK-GspI-GspJ complex from enterotoxigenic Escherichia coli Type 2 Secretion System

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pseudopilin GspI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pseudopilin GspJ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pseudopilin GspK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ci0__assembly_1__model_1

3ci0__assembly_1__model_1 | I(q)

3ci0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (5 domains)

CATH v4.4 (6 domains)

7. Citations (1)