3cxc

The structure of an enhanced oxazolidinone inhibitor bound to the 50S ribosomal subunit of H. marismortui

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RIBOSOMAL PROTEIN L2

OrganismNot specified

UniProt P20276

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_HALMA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–239； UniProt 1–239

RIBOSOMAL PROTEIN L3

OrganismNot specified

UniProt P20279

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_HALMA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–337； UniProt 2–338

RIBOSOMAL PROTEIN L4

OrganismNot specified

UniProt P12735

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_HALMA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–246； UniProt 1–246

RIBOSOMAL PROTEIN L5

OrganismNot specified

UniProt P14124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_HALMA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–176； UniProt 1–176

RIBOSOMAL PROTEIN L6

OrganismNot specified

UniProt P14135

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_HALMA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–177； UniProt 2–178

RIBOSOMAL PROTEIN L7AE

OrganismNot specified

UniProt P12743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_HALMA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain F； PDBConstruct 1–119； UniProt 2–120

RIBOSOMAL PROTEIN L10

OrganismNot specified

UniProt P15825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RLA0_HALMA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain G； PDBConstruct 1–348； UniProt 1–348

RIBOSOMAL PROTEIN L13

OrganismNot specified

UniProt P29198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_HALMA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain I； PDBConstruct 1–145； UniProt 1–145

RIBOSOMAL PROTEIN L14

OrganismNot specified

UniProt P22450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_HALMA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain J； PDBConstruct 1–132； UniProt 1–132

RIBOSOMAL PROTEIN L15

OrganismNot specified

UniProt P12737

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_HALMA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain K； PDBConstruct 1–164； UniProt 1–164

RIBOSOMAL PROTEIN L18

OrganismNot specified

UniProt P14123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_HALMA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain M； PDBConstruct 1–186； UniProt 1–186

RIBOSOMAL PROTEIN L18E

OrganismNot specified

UniProt P12733

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_HALMA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain N； PDBConstruct 1–115； UniProt 1–115

RIBOSOMAL PROTEIN L19E

OrganismNot specified

UniProt P14119

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL19_HALMA
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain O； PDBConstruct 1–148； UniProt 1–148

RIBOSOMAL PROTEIN L21E

OrganismNot specified

UniProt P12734

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_HALMA
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain P； PDBConstruct 1–95； UniProt 1–95

RIBOSOMAL PROTEIN L22

OrganismNot specified

UniProt P10970

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_HALMA
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain Q； PDBConstruct 1–154； UniProt 1–154

RIBOSOMAL PROTEIN L23

OrganismNot specified

UniProt P12732

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_HALMA
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain R； PDBConstruct 1–84； UniProt 1–84

RIBOSOMAL PROTEIN L24

OrganismNot specified

UniProt P10972

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_HALMA
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain S； PDBConstruct 1–119； UniProt 1–119

RIBOSOMAL PROTEIN L24E

OrganismNot specified

UniProt P14116

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_HALMA
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain T； PDBConstruct 1–66； UniProt 1–66

RIBOSOMAL PROTEIN L29

OrganismNot specified

UniProt P10971

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_HALMA
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain U； PDBConstruct 1–70； UniProt 1–70

RIBOSOMAL PROTEIN L30

OrganismNot specified

UniProt P14121

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_HALMA
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain V； PDBConstruct 1–154； UniProt 1–154

RIBOSOMAL PROTEIN L31E

OrganismNot specified

UniProt P18138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_HALMA
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain W； PDBConstruct 1–91； UniProt 1–91

RIBOSOMAL PROTEIN L32E

OrganismNot specified

UniProt P12736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL32_HALMA
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain X； PDBConstruct 1–240； UniProt 2–241

RIBOSOMAL PROTEIN L37E

OrganismNot specified

UniProt P32410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L39E × 1 （P22452） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_HALMA
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain Z； PDBConstruct 1–56； UniProt 1–56

RIBOSOMAL PROTEIN L39E

OrganismNot specified

UniProt P22452

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L44E × 1 （P32411） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_HALMA
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 1； PDBConstruct 1–48； UniProt 1–49

RIBOSOMAL PROTEIN L44E

OrganismNot specified

UniProt P32411

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 28 RNA 3	23S RIBOSOMAL RNA × 1 5S RIBOSOMAL RNA × 1 5'-R(CPCP*A)-3' × 1 RIBOSOMAL PROTEIN L2 × 1 （P20276） RIBOSOMAL PROTEIN L3 × 1 （P20279） RIBOSOMAL PROTEIN L4 × 1 （P12735） RIBOSOMAL PROTEIN L5 × 1 （P14124） RIBOSOMAL PROTEIN L6 × 1 （P14135） RIBOSOMAL PROTEIN L7AE × 1 （P12743） RIBOSOMAL PROTEIN L10 × 1 （P15825） RIBOSOMAL PROTEIN L10E × 1 RIBOSOMAL PROTEIN L13 × 1 （P29198） RIBOSOMAL PROTEIN L14 × 1 （P22450） RIBOSOMAL PROTEIN L15 × 1 （P12737） RIBOSOMAL PROTEIN L15E × 1 RIBOSOMAL PROTEIN L18 × 1 （P14123） RIBOSOMAL PROTEIN L18E × 1 （P12733） RIBOSOMAL PROTEIN L19E × 1 （P14119） RIBOSOMAL PROTEIN L21E × 1 （P12734） RIBOSOMAL PROTEIN L22 × 1 （P10970） RIBOSOMAL PROTEIN L23 × 1 （P12732） RIBOSOMAL PROTEIN L24 × 1 （P10972） RIBOSOMAL PROTEIN L24E × 1 （P14116） RIBOSOMAL PROTEIN L29 × 1 （P10971） RIBOSOMAL PROTEIN L30 × 1 （P14121） RIBOSOMAL PROTEIN L31E × 1 （P18138） RIBOSOMAL PROTEIN L32E × 1 （P12736） RIBOSOMAL PROTEIN L37AE × 1 RIBOSOMAL PROTEIN L37E × 1 （P32410） RIBOSOMAL PROTEIN L39E × 1 （P22452） ;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ; × 1 MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 31	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL44_HALMA
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 2； PDBConstruct 1–92； UniProt 1–92

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3cxc
Deposition date deposition_date	2008-04-24
Structure title title	The structure of an enhanced oxazolidinone inhibitor bound to the 50S ribosomal subunit of H. marismortui
Keywords keywords	50S RIBOSOMAL SUBUNIT, OXAZOLIDINONE, RIBOSOME; RIBOSOME
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3cxc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3cxc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3cxc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.44 Å
Rg (electron density)	69.19 Å
Total Rg	69.10 Å
Atom count	90765
Residues	6580
Excluded volume	1382200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3cxc__assembly_1__model_1`	31-meric （31）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (38)

Entity 1 Entity 1 polymer

Description description	23S RIBOSOMAL RNA
Molecular weight formula_weight	946034.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	0
Atom count atom_count	98635

UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAGCCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGAGCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCGACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAGGUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU

Entity 2 Entity 2 polymer

Description description	5S RIBOSOMAL RNA
Molecular weight formula_weight	39318.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	9

UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC

Entity 3 Entity 3 polymer

Description description	5'-R(CPCP*A)-3'
Molecular weight formula_weight	894.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

CCA

Entity 4 Entity 4 polymer

Description description	RIBOSOMAL PROTEIN L2
Molecular weight formula_weight	25237.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVGGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

Entity 5 Entity 5 polymer

Description description	RIBOSOMAL PROTEIN L3
Molecular weight formula_weight	37265.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG

Entity 6 Entity 6 polymer

Description description	RIBOSOMAL PROTEIN L4
Molecular weight formula_weight	26442.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER

Entity 7 Entity 7 polymer

Description description	RIBOSOMAL PROTEIN L5
Molecular weight formula_weight	19420.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEVSE

Entity 8 Entity 8 polymer

Description description	RIBOSOMAL PROTEIN L6
Molecular weight formula_weight	19830.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKPNRGDA

Entity 9 Entity 9 polymer

Description description	RIBOSOMAL PROTEIN L7AE
Molecular weight formula_weight	12600.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR

Entity 10 Entity 10 polymer

Description description	RIBOSOMAL PROTEIN L10
Molecular weight formula_weight	37213.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLSDSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATTAPTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDDADADDAAEEADDDDDDDEDAGDALGAMF

Entity 11 Entity 11 polymer

Description description	RIBOSOMAL PROTEIN L10E
Molecular weight formula_weight	18022.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA

Entity 12 Entity 12 polymer

Description description	RIBOSOMAL PROTEIN L13
Molecular weight formula_weight	16249.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW

Entity 13 Entity 13 polymer

Description description	RIBOSOMAL PROTEIN L14
Molecular weight formula_weight	14216.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV

Entity 14 Entity 14 polymer

Description description	RIBOSOMAL PROTEIN L15
Molecular weight formula_weight	17874.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE

Entity 15 Entity 15 polymer

Description description	RIBOSOMAL PROTEIN L15E
Molecular weight formula_weight	22856.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKGRRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTFRGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA

Entity 16 Entity 16 polymer

Description description	RIBOSOMAL PROTEIN L18
Molecular weight formula_weight	20509.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL

Entity 17 Entity 17 polymer

Description description	RIBOSOMAL PROTEIN L18E
Molecular weight formula_weight	12307.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR

Entity 18 Entity 18 polymer

Description description	RIBOSOMAL PROTEIN L19E
Molecular weight formula_weight	16631.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA

Entity 19 Entity 19 polymer

Description description	RIBOSOMAL PROTEIN L21E
Molecular weight formula_weight	10436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE

Entity 20 Entity 20 polymer

Description description	RIBOSOMAL PROTEIN L22
Molecular weight formula_weight	16835.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED

Entity 21 Entity 21 polymer

Description description	RIBOSOMAL PROTEIN L23
Molecular weight formula_weight	9481.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRIGVF

Entity 22 Entity 22 polymer

Description description	RIBOSOMAL PROTEIN L24
Molecular weight formula_weight	13539.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA

Entity 23 Entity 23 polymer

Description description	RIBOSOMAL PROTEIN L24E
Molecular weight formula_weight	7233.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA

Entity 24 Entity 24 polymer

Description description	RIBOSOMAL PROTEIN L29
Molecular weight formula_weight	7758.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE

Entity 25 Entity 25 polymer

Description description	RIBOSOMAL PROTEIN L30
Molecular weight formula_weight	17062.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR

Entity 26 Entity 26 polymer

Description description	RIBOSOMAL PROTEIN L31E
Molecular weight formula_weight	10253.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAETAE

Entity 27 Entity 27 polymer

Description description	RIBOSOMAL PROTEIN L32E
Molecular weight formula_weight	26324.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEVEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

Entity 28 Entity 28 polymer

Description description	RIBOSOMAL PROTEIN L37AE
Molecular weight formula_weight	8097.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA

Entity 29 Entity 29 polymer

Description description	RIBOSOMAL PROTEIN L37E
Molecular weight formula_weight	6199.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE

Entity 30 Entity 30 polymer

Description description	RIBOSOMAL PROTEIN L39E
Molecular weight formula_weight	5844.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE

Entity 31 Entity 31 polymer

Description description	RIBOSOMAL PROTEIN L44E
Molecular weight formula_weight	10815.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE

Entity 32 Entity 32 non-polymer

Description description	;(3Z)-N-[(4E)-5-(4-{(5S)-5-[(acetylamino)methyl]-2-oxo-1,3-oxazolidin-3-yl}-2-fluorophenyl)pent-4-en-1-yl]-3-(4-methyl-2,6-dioxo-1,6-dihydropyrimidin-5(2H)-ylidene)propanamide ;
Molecular weight formula_weight	513.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	117

Entity 34 Entity 34 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 35 Entity 35 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	86

Entity 36 Entity 36 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 37 Entity 37 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 38 Entity 38 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	7870

▼

6. Fold Classification (SCOP + CATH) 33 domains

CATH v4.4 (33 domains)

Domain ID domain_id	3cxc100
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1620 — Atp Synthase Epsilon Chain; Chain: I;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L39

Domain ID domain_id	3cxc200
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	450 — Nuclear Transport Factor 2; Chain: A,
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	3cxcA01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	3cxcA02
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3cxcB01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	960 — Ribosomal protein L3; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L3, domain 3

Domain ID domain_id	3cxcB02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	10 — Translation factors

Domain ID domain_id	3cxcB03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1430 — Ribosomal Protein L3; Chain: B; domain 2,
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cxcC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1370 — Ribosomal Protein L4; Chain: A;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L4/L1

Domain ID domain_id	3cxcD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1440 — 50s Ribosomal Protein L5; Chain: A,
Homologous superfamily homologous superfamily	10 — Ribosomal protein L5

Domain ID domain_id	3cxcE01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	930 — Outer Surface Protein A; domain 3
Homologous superfamily homologous superfamily	12 — Ribosomal protein L6

Domain ID domain_id	3cxcE02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	930 — Outer Surface Protein A; domain 3
Homologous superfamily homologous superfamily	12 — Ribosomal protein L6

Domain ID domain_id	3cxcF00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/S12

Domain ID domain_id	3cxcH00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1170 — Aldehyde Oxidoreductase; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L16/L10

Domain ID domain_id	3cxcI00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1180 — Ribosomal Protein L13p; Chain: A;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L13

Domain ID domain_id	3cxcJ00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	150 — Ribosomal Protein L14
Homologous superfamily homologous superfamily	20 — Ribosomal protein L14/L23

Domain ID domain_id	3cxcK01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	990 — Molecule: Ribosomal Protein L15; Chain: K; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cxcK02
Class class	3 — Alpha Beta
Architecture architecture	100 — Ribosomal Protein L15; Chain: K; domain 2
Topology topology	10 — Ribosomal Protein L15; Chain: K; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cxcL00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1120 — Ribosomal protein L15e
Homologous superfamily homologous superfamily	10 — Ribosomal protein L15

Domain ID domain_id	3cxcM00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3cxcN00
Class class	3 — Alpha Beta
Architecture architecture	100 — Ribosomal Protein L15; Chain: K; domain 2
Topology topology	10 — Ribosomal Protein L15; Chain: K; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cxcO01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1650 — 50s Ribosomal Protein L19e, Chain O, domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3cxcO02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1200 — Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
Homologous superfamily homologous superfamily	60 —

Domain ID domain_id	3cxcP00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	70 — Ribosomal protein L21

Domain ID domain_id	3cxcQ00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	470 — Ribosomal Protein L22; Chain A
Homologous superfamily homologous superfamily	10 — Ribosomal protein L22/L17

Domain ID domain_id	3cxcR00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	3cxcS00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3cxcT00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	170 — Ribosomal Protein L24e; Chain: T;
Homologous superfamily homologous superfamily	20 — Ribosomal protein L24

Domain ID domain_id	3cxcU00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	310 —

Domain ID domain_id	3cxcV01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1390 — Ribosomal Protein L30; Chain: A,
Homologous superfamily homologous superfamily	20 — Ribosomal protein L30/L7

Domain ID domain_id	3cxcV02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	15 — 3-methyladenine DNA Glycosylase II; Chain A, domain 3
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/L7, central domain

Domain ID domain_id	3cxcW00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	440 — Ribosomal Protein L31e; Chain: W;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L31

Domain ID domain_id	3cxcY00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3cxcZ00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	213.660 Å
Unit-cell length b length_b	300.710 Å
Unit-cell length c length_c	575.370 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	—
R_work r_work	0.1856
R_free r_free	0.2292

The structure of an enhanced oxazolidinone inhibitor bound to the 50S ribosomal subunit of H. marismortui

1. Protein Identity and Related Structures Protein Identity & Related Structures

RIBOSOMAL PROTEIN L2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L7AE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBOSOMAL PROTEIN L15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer