3d54

Structure of PurLQS from Thermotoga maritima

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phosphoribosylformylglycinamidine synthase II

Thermotoga maritima

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Formylglycinamide ribonucleotide amidotransferase × 2 （Q9X0X1） Phosphoribosylformylglycinamidine synthase 1 × 1 （Q9X0X2） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Formylglycinamide ribonucleotide amidotransferase × 2 （Q9X0X1） Phosphoribosylformylglycinamidine synthase 1 × 1 （Q9X0X2） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Formylglycinamide ribonucleotide amidotransferase × 2 （Q9X0X1） Phosphoribosylformylglycinamidine synthase 1 × 1 （Q9X0X2） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PURL_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 27–629； UniProt 1–603 Author chain E； PDBConstruct 27–629； UniProt 1–603 Author chain I； PDBConstruct 27–629； UniProt 1–603

Formylglycinamide ribonucleotide amidotransferase

Thermotoga maritima

UniProt Q9X0X1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Phosphoribosylformylglycinamidine synthase II × 1 （Q9X0X3） Phosphoribosylformylglycinamidine synthase 1 × 1 （Q9X0X2） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Phosphoribosylformylglycinamidine synthase II × 1 （Q9X0X3） Phosphoribosylformylglycinamidine synthase 1 × 1 （Q9X0X2） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Phosphoribosylformylglycinamidine synthase II × 1 （Q9X0X3） Phosphoribosylformylglycinamidine synthase 1 × 1 （Q9X0X2） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9X0X1_THEMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–82； UniProt 1–82 Author chain C； PDBConstruct 1–82； UniProt 1–82 Author chain F； PDBConstruct 1–82； UniProt 1–82 Author chain G； PDBConstruct 1–82； UniProt 1–82 Author chain J； PDBConstruct 1–82； UniProt 1–82 Author chain K； PDBConstruct 1–82； UniProt 1–82

Phosphoribosylformylglycinamidine synthase 1

Thermotoga maritima

UniProt Q9X0X2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Phosphoribosylformylglycinamidine synthase II × 1 （Q9X0X3） Formylglycinamide ribonucleotide amidotransferase × 2 （Q9X0X1） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Phosphoribosylformylglycinamidine synthase II × 1 （Q9X0X3） Formylglycinamide ribonucleotide amidotransferase × 2 （Q9X0X1） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Phosphoribosylformylglycinamidine synthase II × 1 （Q9X0X3） Formylglycinamide ribonucleotide amidotransferase × 2 （Q9X0X1） SODIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PURQ_THEMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–213； UniProt 1–213 Author chain H； PDBConstruct 1–213； UniProt 1–213 Author chain L； PDBConstruct 1–213； UniProt 1–213

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3d54
Deposition date deposition_date	2008-05-15
Structure title title	Structure of PurLQS from Thermotoga maritima
Keywords keywords	;alpha-beta structure, ATP-binding, Ligase, Nucleotide-binding, Purine biosynthesis, Glutamine amidotransferase, LIGASE-UNKNOWN FUNCTION COMPLEX ;; LIGASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3d54__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3d54__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3d54__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.94 Å
Rg (electron density)	29.10 Å
Total Rg	29.95 Å
Atom count	7528
Residues	958
Excluded volume	134830 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3d54__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3d54__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3d54__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Phosphoribosylformylglycinamidine synthase II
Molecular weight formula_weight	69109.0 kDa
EC 编号 ec_number	6.3.5.3
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,I
Atom count atom_count	22584

MGSHHHHHHDITSLYKKAGSENLYFQMKLRYLNILKEKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTGFEGNAGVVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSRIIDGIIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKASRPGQVIVIFGGATGRDGIHGASFASEDLTGDKATKLSIQVGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAGGVLSATSELVAKGNLGAIVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRNDLVMEVPVQLLANAPEEDIVEYTPGKIPEFKRVEFEEVNAREVFEQYDHMVGTDTVVPPGFGAAVMRIKRDGGYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYGDPDVDPVGLSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQKVAKPKPSKVFAVGWNDFELEREKELWRAIRKLSEEGAFILSSSQLLTRTHVETFREYGLKIEVKLPEVRPAHQMVLVFSERTPVVDVPVKEIGTLSR

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Formylglycinamide ribonucleotide amidotransferase
Molecular weight formula_weight	9656.2 kDa
EC 编号 ec_number	6.3.5.3
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,F,G,J,K

MPLFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEIVKKACEELLVNPVVEEYEVREL

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Phosphoribosylformylglycinamidine synthase 1
Molecular weight formula_weight	23746.2 kDa
EC 编号 ec_number	6.3.5.3
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H,L

MKPRACVVVYPGSNCDRDAYHALEINGFEPSYVGLDDKLDDYELIILPGGFSYGDYLRPGAVAAREKIAFEIAKAAERGKLIMGICNGFQILIEMGLLKGALLQNSSGKFICKWVDLIVENNDTPFTNAFEKGEKIRIPIAHGFGRYVKIDDVNVVLRYVKDVNGSDERIAGVLNESGNVFGLMPHPERAVEELIGGEDGKKVFQSILNYLKR

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 33 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d3d54a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.4 — PurM N-terminal domain-like
Family Family family	d.79.4.1 — PurM N-terminal domain-like

Domain ID domain_id	d3d54a2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.4 — PurM N-terminal domain-like
Family Family family	d.79.4.1 — PurM N-terminal domain-like

Domain ID domain_id	d3d54a3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.139 — PurM C-terminal domain-like
Superfamily Superfamily superfamily	d.139.1 — PurM C-terminal domain-like
Family Family family	d.139.1.1 — PurM C-terminal domain-like

Domain ID domain_id	d3d54a4
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.139 — PurM C-terminal domain-like
Superfamily Superfamily superfamily	d.139.1 — PurM C-terminal domain-like
Family Family family	d.139.1.1 — PurM C-terminal domain-like

Domain ID domain_id	d3d54e1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.4 — PurM N-terminal domain-like
Family Family family	d.79.4.1 — PurM N-terminal domain-like

Domain ID domain_id	d3d54e2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.4 — PurM N-terminal domain-like
Family Family family	d.79.4.1 — PurM N-terminal domain-like

Domain ID domain_id	d3d54e3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.139 — PurM C-terminal domain-like
Superfamily Superfamily superfamily	d.139.1 — PurM C-terminal domain-like
Family Family family	d.139.1.1 — PurM C-terminal domain-like

Domain ID domain_id	d3d54e4
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.139 — PurM C-terminal domain-like
Superfamily Superfamily superfamily	d.139.1 — PurM C-terminal domain-like
Family Family family	d.139.1.1 — PurM C-terminal domain-like

Domain ID domain_id	d3d54i1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.4 — PurM N-terminal domain-like
Family Family family	d.79.4.1 — PurM N-terminal domain-like

Domain ID domain_id	d3d54i2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.4 — PurM N-terminal domain-like
Family Family family	d.79.4.1 — PurM N-terminal domain-like

Domain ID domain_id	d3d54i3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.139 — PurM C-terminal domain-like
Superfamily Superfamily superfamily	d.139.1 — PurM C-terminal domain-like
Family Family family	d.139.1.1 — PurM C-terminal domain-like

Domain ID domain_id	d3d54i4
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.139 — PurM C-terminal domain-like
Superfamily Superfamily superfamily	d.139.1 — PurM C-terminal domain-like
Family Family family	d.139.1.1 — PurM C-terminal domain-like

CATH v4.4 (21 domains)

Domain ID domain_id	3d54A01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	650 — Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — PurM-like C-terminal domain

Domain ID domain_id	3d54A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	10 — PurM-like, N-terminal domain

Domain ID domain_id	3d54A03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	10 — PurM-like, N-terminal domain

Domain ID domain_id	3d54A04
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1670 — Formylglycinamide ribonucleotide amidotransferase, C-terminal domain

Domain ID domain_id	3d54B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1280 — Mth169; Chain: A ,
Homologous superfamily homologous superfamily	10 — Phosphoribosylformylglycinamidine synthase subunit PurS

Domain ID domain_id	3d54C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1280 — Mth169; Chain: A ,
Homologous superfamily homologous superfamily	10 — Phosphoribosylformylglycinamidine synthase subunit PurS

Domain ID domain_id	3d54D00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	880 — Class I glutamine amidotransferase (GATase) domain

Domain ID domain_id	3d54E01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	650 — Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — PurM-like C-terminal domain

Domain ID domain_id	3d54E02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	10 — PurM-like, N-terminal domain

Domain ID domain_id	3d54E03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	10 — PurM-like, N-terminal domain

Domain ID domain_id	3d54E04
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1670 — Formylglycinamide ribonucleotide amidotransferase, C-terminal domain

Domain ID domain_id	3d54F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1280 — Mth169; Chain: A ,
Homologous superfamily homologous superfamily	10 — Phosphoribosylformylglycinamidine synthase subunit PurS

Domain ID domain_id	3d54G00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1280 — Mth169; Chain: A ,
Homologous superfamily homologous superfamily	10 — Phosphoribosylformylglycinamidine synthase subunit PurS

Domain ID domain_id	3d54H00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	880 — Class I glutamine amidotransferase (GATase) domain

Domain ID domain_id	3d54I01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	650 — Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — PurM-like C-terminal domain

Domain ID domain_id	3d54I02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	10 — PurM-like, N-terminal domain

Domain ID domain_id	3d54I03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	10 — PurM-like, N-terminal domain

Domain ID domain_id	3d54I04
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1670 — Formylglycinamide ribonucleotide amidotransferase, C-terminal domain

Domain ID domain_id	3d54J00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1280 — Mth169; Chain: A ,
Homologous superfamily homologous superfamily	10 — Phosphoribosylformylglycinamidine synthase subunit PurS

Domain ID domain_id	3d54K00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1280 — Mth169; Chain: A ,
Homologous superfamily homologous superfamily	10 — Phosphoribosylformylglycinamidine synthase subunit PurS

Domain ID domain_id	3d54L00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	880 — Class I glutamine amidotransferase (GATase) domain

▶

Unit-cell length a length_a	256.851 Å
Unit-cell length b length_b	187.337 Å
Unit-cell length c length_c	159.177 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	99.12 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	45.700 Å
R factor r_factor	0.2520
R_work r_work	0.2520
R_free r_free	0.2820

Structure of PurLQS from Thermotoga maritima

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phosphoribosylformylglycinamidine synthase II

State in the Current Structure

Other States of the Same Protein in the Database

Formylglycinamide ribonucleotide amidotransferase

State in the Current Structure

Other States of the Same Protein in the Database

Phosphoribosylformylglycinamidine synthase 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3d54__assembly_1__model_1

3d54__assembly_1__model_1 | I(q)

3d54__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 33 domains

SCOP 2.08 (12 domains)

CATH v4.4 (21 domains)

7. Citations (1)

Structure of PurLQS from Thermotoga maritima

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phosphoribosylformylglycinamidine synthase II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Formylglycinamide ribonucleotide amidotransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phosphoribosylformylglycinamidine synthase 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3d54__assembly_1__model_1

3d54__assembly_1__model_1 | I(q)

3d54__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 33 domains

SCOP 2.08 (12 domains)

CATH v4.4 (21 domains)

7. Citations (1)