SAXSdb — 3dfx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Trans-acting T-cell-specific transcription factor GATA-3

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Homooligomer	Protein 2 DNA 2	;DNA (5'-D(DTPDTPDGPDAPDTPDAPDAPDAPDTPDCPDAPDGPDAPDGPDAPDTPDAPDAPDCPDC)-3') ; × 1 ;DNA (5'-D(DAPDAPDGPDGPDTPDTPDAPDTPDCPDTPDCPDTPDGPDAPDTPDTPDTPDAPDTPDC)-3') ; × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GATA3_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–63； UniProt 308–370 Author chain B； PDBConstruct 1–63； UniProt 308–370

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3dfx
Deposition date deposition_date	2008-06-12
Structure title title	Opposite GATA DNA binding
Keywords keywords	;Activator, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc, Zinc-finger, Transcription-DNA COMPLEX ;; Transcription/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3dfx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3dfx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3dfx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.50 Å
Rg (electron density)	20.14 Å
Total Rg	20.79 Å
Atom count	1710
Residues	156
Excluded volume	27621 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3dfx__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	;DNA (5'-D(DTPDTPDGPDAPDTPDAPDAPDAPDTPDCPDAPDGPDAPDGPDAPDTPDAPDAPDCPDC)-3') ;
Molecular weight formula_weight	6150.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X
Atom count atom_count	1710

TTGATAAATCAGAGATAACC

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(DAPDAPDGPDGPDTPDTPDAPDTPDCPDTPDCPDTPDGPDAPDTPDTPDTPDAPDTPDC)-3') ;
Molecular weight formula_weight	6114.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

AAGGTTATCTCTGATTTATC

Entity 3 Entity 3 polymer

Description description	Trans-acting T-cell-specific transcription factor GATA-3
Molecular weight formula_weight	7044.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSS

Source Source

Source organism organism	Mus musculus
Common name common_name	mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3dfxa_
Class class	g — Small proteins
Fold Fold fold	g.39 — Glucocorticoid receptor-like (DNA-binding domain)
Superfamily Superfamily superfamily	g.39.1 — Glucocorticoid receptor-like (DNA-binding domain)
Family Family family	g.39.1.1 — Erythroid transcription factor GATA-1

Domain ID domain_id	d3dfxb_
Class class	g — Small proteins
Fold Fold fold	g.39 — Glucocorticoid receptor-like (DNA-binding domain)
Superfamily Superfamily superfamily	g.39.1 — Glucocorticoid receptor-like (DNA-binding domain)
Family Family family	g.39.1.1 — Erythroid transcription factor GATA-1

CATH v4.4 (2 domains)

Domain ID domain_id	3dfxA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	50 — Erythroid Transcription Factor GATA-1; Chain A
Homologous superfamily homologous superfamily	10 — Erythroid Transcription Factor GATA-1, subunit A

Domain ID domain_id	3dfxB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	50 — Erythroid Transcription Factor GATA-1; Chain A
Homologous superfamily homologous superfamily	10 — Erythroid Transcription Factor GATA-1, subunit A

▶

Unit-cell length a length_a	128.882 Å
Unit-cell length b length_b	30.370 Å
Unit-cell length c length_c	75.648 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.82 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	25.320 Å
R factor r_factor	—
R_work r_work	0.2760
R_free r_free	0.2980

Opposite GATA DNA binding

1. Protein Identity and Related Structures Protein Identity & Related Structures

Trans-acting T-cell-specific transcription factor GATA-3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dfx__assembly_1__model_1

3dfx__assembly_1__model_1 | I(q)

3dfx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Opposite GATA DNA binding

1. Protein Identity and Related Structures Protein Identity & Related Structures

Trans-acting T-cell-specific transcription factor GATA-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dfx__assembly_1__model_1

3dfx__assembly_1__model_1 | I(q)

3dfx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)