3edl

Kinesin13-Microtubule Ring complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 165	Beta tubulin × 66 （P02554） Kinesin-like protein KIF2C × 33 （Q922S8） ZINC ION × 33 MAGNESIUM ION × 99 GUANOSINE-5'-TRIPHOSPHATE × 66 GUANOSINE-5'-DIPHOSPHATE × 66 TAXOL × 33 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 33 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 33 water × 66	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Beta tubulin × 2 （P02554） Kinesin-like protein KIF2C × 1 （Q922S8） ZINC ION × 1 MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 2 TAXOL × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Beta tubulin × 2 （P02554） Kinesin-like protein KIF2C × 1 （Q922S8） ZINC ION × 1 MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 2 TAXOL × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_PIG
Isoform	—
PDB entities	1, 4
Chains and sequence ranges	Author chain A； PDBConstruct 1–451； UniProt 1–451 Author chain F； PDBConstruct 1–451； UniProt 1–451

Beta tubulin

OrganismNot specified

UniProt P02554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 165	Tubulin alpha-1A chain × 33 （P02550） Kinesin-like protein KIF2C × 33 （Q922S8） Tubulin alpha-1A chain × 33 （P02550） ZINC ION × 33 MAGNESIUM ION × 99 GUANOSINE-5'-TRIPHOSPHATE × 66 GUANOSINE-5'-DIPHOSPHATE × 66 TAXOL × 33 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 33 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 33 water × 66	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Tubulin alpha-1A chain × 1 （P02550） Kinesin-like protein KIF2C × 1 （Q922S8） Tubulin alpha-1A chain × 1 （P02550） ZINC ION × 1 MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 2 TAXOL × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Tubulin alpha-1A chain × 1 （P02550） Kinesin-like protein KIF2C × 1 （Q922S8） Tubulin alpha-1A chain × 1 （P02550） ZINC ION × 1 MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 2 TAXOL × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–445； UniProt 1–445 Author chain G； PDBConstruct 1–445； UniProt 1–445

Kinesin-like protein KIF2C

Drosophila melanogaster

UniProt Q922S8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 165	Tubulin alpha-1A chain × 33 （P02550） Beta tubulin × 66 （P02554） Tubulin alpha-1A chain × 33 （P02550） ZINC ION × 33 MAGNESIUM ION × 99 GUANOSINE-5'-TRIPHOSPHATE × 66 GUANOSINE-5'-DIPHOSPHATE × 66 TAXOL × 33 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 33 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 33 water × 66	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Tubulin alpha-1A chain × 1 （P02550） Beta tubulin × 2 （P02554） Tubulin alpha-1A chain × 1 （P02550） ZINC ION × 1 MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 2 TAXOL × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Tubulin alpha-1A chain × 1 （P02550） Beta tubulin × 2 （P02554） Tubulin alpha-1A chain × 1 （P02550） ZINC ION × 1 MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 2 TAXOL × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KIF2C_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–331； UniProt 255–585

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3edl
Deposition date deposition_date	2008-09-03
Structure title title	Kinesin13-Microtubule Ring complex
Keywords keywords	Kinesin, Kinesin13, Kin-I, M-Kinesin, Microtubule, Tubulin, depolymerization, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3edl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3edl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3edl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	186.70 Å
Total Rg	186.60 Å
Atom count	500800
Residues	63328
Excluded volume	8854100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3edl__assembly_1__model_1`	165-meric （165）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3edl__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`3edl__assembly_3__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	50107.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	15757

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 2 Entity 2 polymer

Description description	Beta tubulin
Molecular weight formula_weight	49907.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA

Entity 3 Entity 3 polymer

Description description	Kinesin-like protein KIF2C
Molecular weight formula_weight	37072.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

ICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDLLNKKAKLRVLEDSRQQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRTKGRLHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIAMISPGISSCEYTLNTLRYADRVKELS

Source Source

Source organism organism	Drosophila melanogaster
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli BL21

Entity 4 Entity 4 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	50163.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 5 Entity 5 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 7 Entity 7 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 9 Entity 9 non-polymer

Description description	TAXOL
Molecular weight formula_weight	853.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 non-polymer

Description description	2-MERCAPTO-N-[1,2,3,10-TETRAMETHOXY-9-OXO-5,6,7,9-TETRAHYDRO-BENZO[A]HEPTALEN-7-YL]ACETAMIDE
Molecular weight formula_weight	431.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	107

▶

Resolution resolution	28.00 Å
Resolution测定Method resolution_method	HELICAL
颗粒数 num_particles	—

Kinesin13-Microtubule Ring complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Beta tubulin

State in the Current Structure

Other States of the Same Protein in the Database

Kinesin-like protein KIF2C

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3edl__assembly_1__model_1

3edl__assembly_1__model_1 | I(q)

3edl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 water

7. Citations (1)

Kinesin13-Microtubule Ring complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Beta tubulin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Kinesin-like protein KIF2C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3edl__assembly_1__model_1

3edl__assembly_1__model_1 | I(q)

3edl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 water

7. Citations (1)