3eoy

Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer capsid protein sigma-1

reovirus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Junctional adhesion molecule A × 3 （Q9Y624）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Junctional adhesion molecule A × 3 （Q9Y624）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SIGM1_REOVD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–165； UniProt 293–455 Author chain B； PDBConstruct 3–165； UniProt 293–455 Author chain C； PDBConstruct 3–165； UniProt 293–455 Author chain D； PDBConstruct 3–165； UniProt 293–455 Author chain E； PDBConstruct 3–165； UniProt 293–455 Author chain F； PDBConstruct 3–165； UniProt 293–455

Junctional adhesion molecule A

Homo sapiens

UniProt Q9Y624

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Outer capsid protein sigma-1 × 3 （P03528）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Outer capsid protein sigma-1 × 3 （P03528）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	JAM1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 3–104； UniProt 28–129 Author chain H； PDBConstruct 3–104； UniProt 28–129 Author chain I； PDBConstruct 3–104； UniProt 28–129 Author chain J； PDBConstruct 3–104； UniProt 28–129 Author chain K； PDBConstruct 3–104； UniProt 28–129 Author chain L； PDBConstruct 3–104； UniProt 28–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3eoy
Deposition date deposition_date	2008-09-29
Structure title title	Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A
Keywords keywords	;protein complex, virus receptor complex, beta-barrel, beta-spiral repeat, greek key motif, trimer, immunoglobulin superfamily, VIRAL PROTEIN-CELL ADHESION COMPLEX ;; VIRAL PROTEIN/CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3eoy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3eoy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3eoy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.03 Å
Rg (electron density)	29.24 Å
Total Rg	30.00 Å
Atom count	6116
Residues	789
Excluded volume	108280 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3eoy__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3eoy__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Outer capsid protein sigma-1
Molecular weight formula_weight	17921.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	12227

GSSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT

Source Source

Source organism organism	reovirus
NCBI taxonomy ID ncbi_taxonomy_id	10886
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Junctional adhesion molecule A
Molecular weight formula_weight	11518.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L

GSSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	3eoyA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	3eoyB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	3eoyC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	3eoyD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	3eoyE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	3eoyF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	3eoyG00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3eoyH00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3eoyI00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3eoyJ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3eoyK00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3eoyL00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	105.940 Å
Unit-cell length b length_b	124.340 Å
Unit-cell length c length_c	130.659 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2100
R_work r_work	0.2100
R_free r_free	0.2520

Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer capsid protein sigma-1

State in the Current Structure

Other States of the Same Protein in the Database

Junctional adhesion molecule A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3eoy__assembly_1__model_1

3eoy__assembly_1__model_1 | I(q)

3eoy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)

Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer capsid protein sigma-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Junctional adhesion molecule A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3eoy__assembly_1__model_1

3eoy__assembly_1__model_1 | I(q)

3eoy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)