SAXSdb — 3f22

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Double-stranded RNA-specific adenosine deaminase

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Homooligomer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain A； UniProt 133–209 Chain B； UniProt 133–209	Fragment：N-terminal zalpha Domain, UNP residues 133-209	;DNA (5'-D(DTPDCPDGPDTPDAPDCP*DG)-3') ; × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；295 K；2.2M (NH4)2SO4, 10% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.269
2	Protein–DNA Homooligomer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain C； UniProt 133–209	Fragment：N-terminal zalpha Domain, UNP residues 133-209	;DNA (5'-D(DTPDCPDGPDTPDAPDCP*DG)-3') ; × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；295 K；2.2M (NH4)2SO4, 10% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.269

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3F22	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1QBJ CRYSTAL STRUCTURE OF THE ZALPHA Z-DNA COMPLEX Deposited 1999-04-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 133–209（77 aa） Fragment：N-TERMINAL HELIX-TURN-HELIX DOMAIN ZALPHA Chain B 133–209（77 aa） Fragment：N-TERMINAL HELIX-TURN-HELIX DOMAIN ZALPHA	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；HANGING DROP VAPOR DIFFUSION OVER 1.6 M (NH4)2SO4, 10 % GLYCEROL AT 24 DEGREES CELSIUS, pH 5.6	Resolution 2.10 Å R-free 0.265
1QBJ CRYSTAL STRUCTURE OF THE ZALPHA Z-DNA COMPLEX Deposited 1999-04-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 133–209（77 aa） Fragment：N-TERMINAL HELIX-TURN-HELIX DOMAIN ZALPHA	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；HANGING DROP VAPOR DIFFUSION OVER 1.6 M (NH4)2SO4, 10 % GLYCEROL AT 24 DEGREES CELSIUS, pH 5.6	Resolution 2.10 Å R-free 0.265
1QGP NMR STRUCTURE OF THE Z-ALPHA DOMAIN OF ADAR1, 15 STRUCTURES Deposited 1999-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–201（77 aa） Fragment：Z-ALPHA DOMAIN	Mutation：C125S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5；298 K；Ionic strength (raw mmCIF value) 0.137 M NACL；Pressure 1 NMR sample composition NA-PHOSPHATE	Resolution not provided
1XMK The Crystal structure of the Zb domain from the RNA editing enzyme ADAR1 Deposited 2004-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 294–366（73 aa）	Not recorded	CD CADMIUM ION × 2 NI NICKEL (II) ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；312 K；PEG1000, Cadmium Chloride, Nickel Chloride, Tris, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 312K, pH 9.00	Resolution 0.97 Å R-free 0.183
2ACJ Crystal structure of the B/Z junction containing DNA bound to Z-DNA binding proteins Deposited 2005-07-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 140–202（63 aa） Fragment：Zalpha domain, ADAR1 Chain B 140–202（63 aa） Fragment：Zalpha domain, ADAR1 Chain C 140–202（63 aa） Fragment：Zalpha domain, ADAR1 Chain D 140–202（63 aa） Fragment：Zalpha domain, ADAR1	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；295 K；22-23% MPD, 55-60mM sodium acetate, 15-16mM calsium chloride, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.60 Å R-free 0.285
2GXB Crystal Structure of The Za Domain bound to Z-RNA Deposited 2006-05-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 140–202（63 aa） Fragment：Za Domain Chain B 140–202（63 aa） Fragment：Za Domain	Not recorded	NA SODIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 3.6；292 K；40% PEG600, 100mM Sodium Acetate, pH 3.6, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 2.25 Å R-free 0.244
2L54 Solution structure of the Zalpha domain mutant of ADAR1 (N43A,Y47A) Deposited 2010-10-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 136–198（63 aa） Fragment：DRADA 1 domain, UNP residues 136-198	Mutation：N43A, Y47A	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；298 K；Pressure ambient NMR sample composition 50 mM sodium phosphate-1, 50 mM sodium chloride-2, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
2MDR Solution structure of the third double-stranded RNA-binding domain (dsRBD3) of human adenosine-deaminase ADAR1 Deposited 2013-09-17	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 708–801（94 aa） Fragment：UNP residues 708-801	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；313 K；Ionic strength (raw mmCIF value) 120；Pressure ambient NMR sample composition 0.7-0.9 mM [U-99% 13C; U-99% 15N] dsRBD3, 20 mM sodium phosphate, 100 mM potassium chloride, 1 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.7-0.9 mM [U-99% 13C; U-99% 15N] dsRBD3, 20 mM sodium phosphate, 100 mM potassium chloride, 1 mM DTT, 100% D2O \| 100% D2O NMR sample composition 0.7-0.9 mM [U-99% 15N] dsRBD3, 20 mM sodium phosphate, 100 mM potassium chloride, 1 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.7-0.9 mM dsRBD3, 20 mM sodium phosphate, 100 mM potassium chloride, 1 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3F21 Crystal structure of Zalpha in complex with d(CACGTG) Deposited 2008-10-28	Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 133–209（77 aa） Fragment：N-terminal zalpha Domain, UNP residues 133-209 Chain B 133–209（77 aa） Fragment：N-terminal zalpha Domain, UNP residues 133-209	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；2.2M (NH4)2SO4, 10% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.20 Å R-free 0.279
3F21 Crystal structure of Zalpha in complex with d(CACGTG) Deposited 2008-10-28	Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 133–209（77 aa） Fragment：N-terminal zalpha Domain, UNP residues 133-209	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；2.2M (NH4)2SO4, 10% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.20 Å R-free 0.279
3F23 Crystal structure of Zalpha in complex with d(CGGCCG) Deposited 2008-10-28	Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 133–209（77 aa） Fragment：N-terminal zalpha Domain, UNP residues 133-209 Chain B 133–209（77 aa） Fragment：N-terminal zalpha Domain, UNP residues 133-209	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；2.2M (NH4)2SO4, 10% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.70 Å R-free 0.264
3F23 Crystal structure of Zalpha in complex with d(CGGCCG) Deposited 2008-10-28	Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 133–209（77 aa） Fragment：N-terminal zalpha Domain, UNP residues 133-209	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；2.2M (NH4)2SO4, 10% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.70 Å R-free 0.264
3IRQ Crystal structure of a Z-Z junction Deposited 2009-08-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 140–202（63 aa） Fragment：Zalpha domain Chain B 140–202（63 aa） Fragment：Zalpha domain Chain C 140–202（63 aa） Fragment：Zalpha domain Chain D 140–202（63 aa） Fragment：Zalpha domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；17% PEG 2000, 0.1 M Tris-HCl, 0.2 M ammonium acetate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.271
3IRR Crystal Structure of a Z-Z junction (with HEPES intercalating) Deposited 2009-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 140–202（63 aa） Fragment：Zalpha domain Chain B 140–202（63 aa） Fragment：Zalpha domain Chain C 140–202（63 aa） Fragment：Zalpha domain Chain D 140–202（63 aa） Fragment：Zalpha domain	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；16% PEG 2000 MME, 0.1 M HEPES, 0.2 M ammonium acetate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.65 Å R-free 0.283
5ZU1 Crystal Structure of BZ junction in diverse sequence Deposited 2018-05-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 140–198（59 aa） Chain B 140–198（59 aa） Chain C 140–198（59 aa） Chain D 140–198（59 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；pH 4.5；296 K；25% 2-methyl-2,4-pentanediol (MPD), 100mM NaOAC, pH 4.5	Resolution 3.01 Å R-free 0.280
5ZUO Crystal Structure of BZ junction in diverse sequence Deposited 2018-05-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 140–202（63 aa） Chain B 140–202（63 aa） Chain C 140–202（63 aa） Chain D 140–202（63 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；pH 7.5；296 K；20% dioxane, with microseeding of small crystals	Resolution 2.90 Å R-free 0.301
5ZUP Crystal Structure of BZ junction in diverse sequence Deposited 2018-05-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 140–202（63 aa） Chain B 140–202（63 aa） Chain C 140–202（63 aa） Chain D 140–202（63 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；pH 7.5；296 K；25% ethylene glycol, with microseeding of small crystal	Resolution 2.90 Å R-free 0.282
7C0I Crystal structure of chimeric mutant of E3L in complex with Z-DNA Deposited 2020-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 169–184（16 aa） Chain A 192–193（2 aa） Chain A 195–195（1 aa） Chain B 169–184（16 aa） Chain B 192–193（2 aa） Chain B 195–195（1 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；295 K；Sodium citrate pH 4.0, Ammonium sulfate, ethylene glycol	Resolution 2.40 Å R-free 0.227
7C0I Crystal structure of chimeric mutant of E3L in complex with Z-DNA Deposited 2020-05-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 169–184（16 aa） Chain C 192–193（2 aa） Chain C 195–195（1 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；295 K；Sodium citrate pH 4.0, Ammonium sulfate, ethylene glycol	Resolution 2.40 Å R-free 0.227
7C0J Crystal structure of chimeric mutant of GH5 in complex with Z-DNA Deposited 2020-05-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 169–178（10 aa） Chain A 192–192（1 aa） Chain A 195–195（1 aa） Chain B 169–178（10 aa） Chain B 192–192（1 aa） Chain B 195–195（1 aa）	Mutation：K41G,S42E,R43G,K53A,R95A Mutation：K41G,S42E,R43G,K53A,R95A Mutation：K41G,S42E,R43G,K53A,R95A Mutation：K41G,S42E,R43G,K53A,R95A Mutation：K41G,S42E,R43G,K53A,R95A Mutation：K41G,S42E,R43G,K53A,R95A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；MES pH 6.0, PEG 4000, ethylene glycol	Resolution 2.75 Å R-free 0.248
7ZJ1 Crystal structure of ADAR1-dsRBD3 dimer Deposited 2022-04-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 716–797（82 aa） Chain B 716–797（82 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；293 K；100 mM sodium citrate pH 4.0, 20% (w/v) PEG 6000, and 1.0 M LiCl	Resolution 1.65 Å R-free 0.225
7ZLQ Crystal structure of ADAR1-dsRBD3 dimer in complex with dsRNA Deposited 2022-04-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 2 PDB declaration: hexameric	Chain A 716–797（82 aa） Chain B 716–797（82 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；50 mM sodium cacodylate, 5% (w/v) PEG 4000, 30 mM CaCl2, 230 mM KCl	Resolution 2.80 Å R-free 0.266
8GBC Homo sapiens Zalpha mutant - N173S Deposited 2023-02-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 140–202（63 aa）	Mutation：N173S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.4；277 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 2 mM [U-13C; U-15N] protein, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
8GBD Homo sapiens Zalpha mutant - P193A Deposited 2023-02-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 140–202（63 aa）	Mutation：P193A	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.4；277 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 2 mM [U-13C; U-15N] protein, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
9B83 Cryo-EM structure of human ADAR1 in complex with dsRNA derived from human GLI1 gene Deposited 2024-03-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 127–1226（1100 aa） Chain B 127–1226（1100 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 2 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
9B84 Cryo-EM structure of human ADAR1 in complex with dsRNA derived from HT2C gene Deposited 2024-03-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 127–1226（1100 aa） Chain B 127–1226（1100 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 2 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9B89 Cryo-EM structure of human ADAR1 in complex with dsRNA derived from HT2C gene in the pre-editing state Deposited 2024-03-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 127–1226（1100 aa） Chain B 127–1226（1100 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 2 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.87 Å

23 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DSRAD_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–81； UniProt 133–209 Author chain B； PDBConstruct 5–81； UniProt 133–209 Author chain C； PDBConstruct 5–81； UniProt 133–209

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3f22
Deposition date deposition_date	2008-10-28
Structure title title	Crystal structure of Zalpha in complex with d(CGTACG)
Keywords keywords	;Protein-Z-DNA complex, Alternative promoter usage, Alternative splicing, Cytoplasm, Disease mutation, DNA-binding, Hydrolase, Metal-binding, mRNA processing, Nucleus, Phosphoprotein, Polymorphism, RNA-binding, RNA-mediated gene silencing, Ubl conjugation, Zinc ;; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.66 Å
Radius of gyration Rg (electron density) rg_electron	21.69 Å
Forward intensity I(0) i0	15454300.00
Molecular weight molecular_weight	27074.0 kDa
Excluded volume excluded_volume	32827 Å³
Envelope volume envelope_volume	41596 Å³
Hydration-shell volume shell_volume	16972 Å³
Envelope diameter envelope_diameter	72.2 Å
Shell Rg shell_rg	26.92 Å
Envelope Rg envelope_rg	21.60 Å
Shape Rg shape_rg	21.70 Å
Total Rg total_rg	22.33 Å
Total atoms total_atoms	1886
Residues n_residues	211
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	70.9 Å
Rg (real space) rg_real	21.67 Å
Rg uncertainty (real space) rg_real_error	0.52 Å
I(0) (real space) i0_real	1.5450e+07
I(0) uncertainty (real space) i0_real_error	2.0690e+05
Rg (reciprocal space) rg_reciprocal	21.67 Å
I(0) (reciprocal space) i0_reciprocal	15450000.0000
Solution quality estimate total_estimate	0.8938
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	20.1 Å
Skewness Skewness skewness	0.264
Kurtosis Kurtosis kurtosis	-0.528
Angular range angular_range	— – 0.3650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2136000.0000
Real-space data points n_real_points	68
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.899; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.922; Smooth: 0.997

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Double-stranded RNA-specific adenosine deaminase
Molecular weight formula_weight	9002.3 kDa
EC 编号 ec_number	3.5.4.-
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	1965

GSHMLSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQAWNQHSG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(DTPDCPDGPDTPDAPDCP*DG)-3') ;
Molecular weight formula_weight	2113.4 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D,E,F

TCGTACG

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	79

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d3f22a_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.19 — Z-DNA binding domain

Domain ID domain_id	d3f22b_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.19 — Z-DNA binding domain

Domain ID domain_id	d3f22c_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.19 — Z-DNA binding domain

CATH v4.4 (3 domains)

Domain ID domain_id	3f22A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3f22B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3f22C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	85.937 Å
Unit-cell length b length_b	85.937 Å
Unit-cell length c length_c	71.201 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 4 21 2
Space-group number int_tables_number	90
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	—
R_work r_work	0.2240
R_free r_free	0.2690

fit	/app/data/saxs_computation/f2/3f22/3f22.fit
pddf	/app/data/pr_computation/f2/3f22/3f22.pr.out
profile	/app/data/saxs_computation/f2/3f22/3f22.dat

Crystal structure of Zalpha in complex with d(CGTACG)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Double-stranded RNA-specific adenosine deaminase

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)