SAXSdb — 7c0j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H5,Double-stranded RNA-specific adenosine deaminase

Gallus gallus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2 DNA 2	;DNA (5'-D(TPCPGPCPGPCP*G)-3') ; × 2 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H5_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–45； UniProt 25–64 Author chain A； PDBConstruct 56–68； UniProt 76–88 Author chain A； PDBConstruct 70–71； UniProt 92–93 Author chain A； PDBConstruct 73–76； UniProt 95–98 Author chain B； PDBConstruct 6–45； UniProt 25–64 Author chain B； PDBConstruct 56–68； UniProt 76–88 Author chain B； PDBConstruct 70–71； UniProt 92–93 Author chain B； PDBConstruct 73–76； UniProt 95–98

Histone H5,Double-stranded RNA-specific adenosine deaminase

Gallus gallus

UniProt P55265

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2 DNA 2	;DNA (5'-D(TPCPGPCPGPCP*G)-3') ; × 2 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DSRAD_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 46–55； UniProt 169–178 Author chain A； PDBConstruct 69–69； UniProt 192–192 Author chain A； PDBConstruct 72–72； UniProt 195–195 Author chain B； PDBConstruct 46–55； UniProt 169–178 Author chain B； PDBConstruct 69–69； UniProt 192–192 Author chain B； PDBConstruct 72–72； UniProt 195–195

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7c0j
Deposition date deposition_date	2020-05-01
Structure title title	Crystal structure of chimeric mutant of GH5 in complex with Z-DNA
Keywords keywords	GH5, Protein-DNA complex, protein engineering, Z-DNA binding protein, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex; DNA BINDING PROTEIN/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7c0j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7c0j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7c0j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.35 Å
Rg (electron density)	19.01 Å
Total Rg	19.46 Å
Atom count	1169
Residues	133
Excluded volume	20104 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7c0j__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Histone H5,Double-stranded RNA-specific adenosine deaminase
Molecular weight formula_weight	8109.3 kDa
Mutation mutation	K41G,S42E,R43G,K53A,R95A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1179

GSHMASHPTYSEMIAAAIRAEGEGGGSSRQSIQAYIKSHYKVGHNKKEINRVLYSLLAAGVLKQTKGVPGSWALAK

Source Source

Source organism organism	Gallus gallus
Common name common_name	Chicken
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(TPCPGPCPGPCP*G)-3') ;
Molecular weight formula_weight	2114.4 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D,E

TCGCGCG

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	10

▶

Unit-cell length a length_a	31.135 Å
Unit-cell length b length_b	47.305 Å
Unit-cell length c length_c	57.118 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	98.41 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	28.876 Å
R factor r_factor	0.2243
R_work r_work	0.2229
R_free r_free	0.2482

Crystal structure of chimeric mutant of GH5 in complex with Z-DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H5,Double-stranded RNA-specific adenosine deaminase

State in the Current Structure

Other States of the Same Protein in the Database

Histone H5,Double-stranded RNA-specific adenosine deaminase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7c0j__assembly_1__model_1

7c0j__assembly_1__model_1 | I(q)

7c0j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of chimeric mutant of GH5 in complex with Z-DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H5,Double-stranded RNA-specific adenosine deaminase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H5,Double-stranded RNA-specific adenosine deaminase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7c0j__assembly_1__model_1

7c0j__assembly_1__model_1 | I(q)

7c0j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)