3h0g

RNA Polymerase II from Schizosaccharomyces pombe

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit rpb1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1752； UniProt 1–1752 Author chain M； PDBConstruct 1–1752； UniProt 1–1752

DNA-directed RNA polymerase II subunit RPB2

OrganismNot specified

UniProt Q02061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1210； UniProt 1–1210 Author chain N； PDBConstruct 1–1210； UniProt 1–1210

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt P37382

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB3_SCHPO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–297； UniProt 1–297 Author chain O； PDBConstruct 1–297； UniProt 1–297

DNA-directed RNA polymerase II subunit rpb4

OrganismNot specified

UniProt O74825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB4_SCHPO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–135； UniProt 1–135 Author chain P； PDBConstruct 1–135； UniProt 1–135

DNA-directed RNA polymerases I, II, and III subunit RPABC1

OrganismNot specified

UniProt Q09191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_SCHPO
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210 Author chain Q； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt P36595

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_SCHPO
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–142； UniProt 1–142 Author chain R； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerase II subunit rpb7

OrganismNot specified

UniProt O14459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB7_SCHPO
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–172； UniProt 1–172 Author chain S； PDBConstruct 1–172； UniProt 1–172

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt Q92399

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_SCHPO
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–125； UniProt 1–125 Author chain T； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt O74635

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_SCHPO
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–113； UniProt 1–113 Author chain U； PDBConstruct 1–113； UniProt 1–113

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt O13877

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_SCHPO
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–71； UniProt 1–71 Author chain V； PDBConstruct 1–71； UniProt 1–71

DNA-directed RNA polymerase II subunit RPB11

OrganismNot specified

UniProt P87123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P48011） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_SCHPO
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–123； UniProt 1–123 Author chain W； PDBConstruct 1–123； UniProt 1–123

DNA-directed RNA polymerases I, II, and III subunit RPABC4

OrganismNot specified

UniProt P48011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase II subunit rpb1 × 1 （P36594） DNA-directed RNA polymerase II subunit RPB2 × 1 （Q02061） DNA-directed RNA polymerase II subunit RPB3 × 1 （P37382） DNA-directed RNA polymerase II subunit rpb4 × 1 （O74825） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P36595） DNA-directed RNA polymerase II subunit rpb7 × 1 （O14459） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q92399） DNA-directed RNA polymerase II subunit RPB9 × 1 （O74635） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （O13877） DNA-directed RNA polymerase II subunit RPB11 × 1 （P87123） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_SCHPO
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–63； UniProt 1–63 Author chain X； PDBConstruct 1–63； UniProt 1–63

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3h0g
Deposition date deposition_date	2009-04-09
Structure title title	RNA Polymerase II from Schizosaccharomyces pombe
Keywords keywords	;Transcription, Multi-protein complex, Polymerase, DNA-binding, DNA-directed RNA polymerase, Magnesium, Metal-binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Transferase, Zinc-finger ;; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3h0g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3h0g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3h0g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.05 Å
Rg (electron density)	51.45 Å
Total Rg	51.67 Å
Atom count	31503
Residues	3962
Excluded volume	560680 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3h0g__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3h0g__assembly_2__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase II subunit rpb1
Molecular weight formula_weight	194372.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,M
Atom count atom_count	62870

MSGIQFSPSSVPLRRVEEVQFGILSPEEIRSMSVAKIEFPETMDESGQRPRVGGLLDPRLGTIDRQFKCQTCGETMADCPGHFGHIELAKPVFHIGFLSKIKKILECVCWNCGKLKIDSSNPKFNDTQRYRDPKNRLNAVWNVCKTKMVCDTGLSAGSDNFDLSNPSANMGHGGCGAAQPTIRKDGLRLWGSWKRGKDESDLPEKRLLSPLEVHTIFTHISSEDLAHLGLNEQYARPDWMIITVLPVPPPSVRPSISVDGTSRGEDDLTHKLSDIIKANANVRRCEQEGAPAHIVSEYEQLLQFHVATYMDNEIAGQPQALQKSGRPLKSIRARLKGKEGRLRGNLMGKRVDFSARTVITGDPNLSLDELGVPRSIAKTLTYPETVTPYNIYQLQELVRNGPDEHPGAKYIIRDTGERIDLRYHKRAGDIPLRYGWRVERHIRDGDVVIFNRQPSLHKMSMMGHRIRVMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSEETRAEIQEITMVPKQIVSPQSNKPVMGIVQDTLAGVRKFSLRDNFLTRNAVMNIMLWVPDWDGILPPPVILKPKVLWTGKQILSLIIPKGINLIRDDDKQSLSNPTDSGMLIENGEIIYGVVDKKTVGASQGGLVHTIWKEKGPEICKGFFNGIQRVVNYWLLHNGFSIGIGDTIADADTMKEVTRTVKEARRQVAECIQDAQHNRLKPEPGMTLRESFEAKVSRILNQARDNAGRSAEHSLKDSNNVKQMVAAGSKGSFINISQMSACVGQQIVEGKRIPFGFKYRTLPHFPKDDDSPESRGFIENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKAMEDVMVRYDGTVRNAMGDIIQFAYGEDGLDATLVEYQVFDSLRLSTKQFEKKYRIDLMEDRSLSLYMENSIENDSSVQDLLDEEYTQLVADRELLCKFIFPKGDARWPLPVNVQRIIQNALQIFHLEAKKPTDLLPSDIINGLNELIAKLTIFRGSDRITRDVQNNATLLFQILLRSKFAVKRVIMEYRLNKVAFEWIMGEVEARFQQAVVSPGEMVGTLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPSLTIYLMPWIAANMDLAKNVQTQIEHTTLSTVTSATEIHYDPDPQDTVIEEDKDFVEAFFAIPDEEVEENLYKQSPWLLRLELDRAKMLDKKLSMSDVAGKIAESFERDLFTIWSEDNADKLIIRCRIIRDDDRKAEDDDNMIEEDVFLKTIEGHMLESISLRGVPNITRVYMMEHKIVRQIEDGTFERADEWVLETDGINLTEAMTVEGVDATRTYSNSFVEILQILGIEATRSALLKELRNVIEFDGSYVNYRHLALLCDVMTSRGHLMAITRHGINRAETGALMRCSFEETVEILMDAAASGEKDDCKGISENIMLGQLAPMGTGAFDIYLDQDMLMNYSLGTAVPTLAGSGMGTSQLPEGAGTPYERSPMVDSGFVGSPDAAAFSPLVQGGSEGREGFGDYGLLGAASPYKGVQSPGYTSPFSSAMSPGYGLTSPSYSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase II subunit RPB2
Molecular weight formula_weight	138027.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,N

MSYEDYQYNETLTQEDCWTVISSFFEETSLARQQLFSFDEFVQNTMQEIVDDDSTLTLDQYAQHTGAQGDVTRRYEINFGQIYLSRPTMTEADGSTTTMFPQEARLRNLTYSSPLYVDMRKKVMVAADSNVPIGEEEWLVEEEDEEPSKVFIGKIPIMLRSTFCILNGVSDSELYDLNECPYDQGGYFIINGSEKVIIAQERSAANIVQVFKKAAPSPIAYVAEIRSALERGSRLISSMQIKLMARNTENSGQTIRATLPYIRSDIPIVIVFRALGVVPDRDILEHICYDPNDFQMLEMMKPCIEEAFVIQDKDIALDYIGKRGSTTGVTREKRLRYAHDILQKELLPHITTMEGFETRKAFFLGYMIHRMLLCALERREPDDRDHFGKKRLDLAGPLLASLFRMLFRKMTRDVYKYMQKCVETNREFNLTLAVKSNIITNGLRYSLATGNWGDQKRSMVNRVGVSQVLNRYTFASTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGMVCPAETPEGQACGLVKNLSLMSYVSVGSPSAPIIEFLEEWGLETLEDYNPSASPNATKVFVNGVWLGVHRDPAHLTETLRSLRRRLDISAEVSIVRDIREKELRLFTDAGRICRPLFIVDNNPNSERRGELCIRKEHIQQLIEDKDRYDIDPEQRFGWTALVSSGLIEYLDAEEEETVMIAMSPEDLEASRQMQAGYEVKEELDPAQRVKPAPNPHVHAWTHCEIHPAMILGILASIIPFPDHNQSPRNTYQSAMGKQAMGVYLTNYQVRMDTMANILYYPQKPLATTRSMEYLKFRELPAGQNAIVAILCYSGYNQEDSIIMNQASIDRGLFRSIFYRTYTDQEKKIGMTVMEEFERPVRSTTLRMKHGTYDKLEDDGLIAPGTRVSGEDIIIGKTAPIPLDHEELGQRTQLHAKRDVSTPLRSTESGIVDQVMVTTNQEGLKFVKVRMRSTRIPQIGDKFASRHGQKGTIGMTYRHEDMPFSAQGIVPDIIINPHAIPSRMTVAHLVECQLSKVSALSGFEGDATPFTDVTVEAVSKLLRSHGFQSRGFEVMYHGHTGRKLVAQVFLGPTYYQRLKHLVDDKIHARARGPVQILTRQPVEGRSRDGGLRFGEMERDCQISHGCSSVLRERLFDCSDAYRVIVCDICGLIAIASYKKDSYECRSCQNRTRFSQVYLPYAAKLLFQELMSMNIAPRLFTKNHK

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	33748.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,O

MDSETHITIRNISKNSVDFVLTNTSLAVANSLRRVVLAEIPTVAIDLVEINVNTSVMPDEFLAHRLGMIPLDSSNIDEPPPVGLEYTRNCDCDQYCPKCSVELFLNAKCTGEGTMEIYARDLVVSSNSSLGHPILADPKSRGPLICKLRKEQEISLRCIAKKGIAKEHAKWSPTSAVAFEYDPWNKLQHTDYWFENDADAEWPKSKNADWEEPPREGEPFNFQEEPRRFYMDVESVGSIPPNEIMVQGLRILQEKLAVLVRDLDEEQPTQLSANELNMEENAEMNWSPYQNGEENTW

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit rpb4
Molecular weight formula_weight	15379.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,P

MPRAIFEEDAAQLKLGPEFENEDMLTVSEAKILIETVLAQRARETNGEIPMTDVMKKTVAYFNVFARFKTAEATYACERILGNRFHKFERAQLGTLCCEDAEEARTLIPSLANKIDDQNLQGILDELSTLRKFQD

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	23954.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,Q

MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLDRTTLSFYAKPSNDSNKGTIYIEFAKEPSVGIKEMRTFVHTLGDHNHKTGILIYANSMTPSAAKIIATVTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELLDRYKLRETQLPRIQLADPVARYLGLKRGEVVKIVRRSETSGRYNSYRICA

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	15742.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,R

MSDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQSGKAVAKEDRTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQKKIPLLVRRYLPDGSYEDWSVAELI

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II subunit rpb7
Molecular weight formula_weight	19122.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,S

MPFFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	14317.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,T

MSESVLLDEIFTVTSVDKQKYQRVSRITAVSGQNDMNLTLDINSQIYPLEKDATFSLQITSNLNSPDLKEAADYIMYGKVYRVEEAKDEKVSVYVSFGGLLMAIEGSHRKLYRLSLDHVYLLLRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	13192.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,U

MSNFQYCIECNNMLYPREDKVDRVLRLACRNCDYSEIAATSKVYRHELQSSNVENTTVSHDASTDPTLPRSDKECPRCHQHEAVFYQTHSRRGDTMMTLIYVCVHCGFAFEEQ

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	8286.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKLLCYNPLSKQKNL

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11
Molecular weight formula_weight	14143.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVEMEFS

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Molecular weight formula_weight	7216.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,X

MNHPTSTGGTAFNPPRPATMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 14 Entity 14 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 48 domains

CATH v4.4 (48 domains)

Domain ID domain_id	3h0gA02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	40 — Barwin-like endoglucanases
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	3h0gA03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	180 — RNA polymerase ii

Domain ID domain_id	3h0gA04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	274 — Enzyme I; Chain A, domain 2
Homologous superfamily homologous superfamily	100 — RNA polymerase Rpb1, domain 3

Domain ID domain_id	3h0gA05
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	132 — Topoisomerase I; Chain A, domain 4
Homologous superfamily homologous superfamily	30 — RNA polymerase Rpb1 funnel domain

Domain ID domain_id	3h0gA08
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	140 —

Domain ID domain_id	3h0gB04
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	3h0gB05
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1070 — Hypothetical Protein Ta0175; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	3h0gB06
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	270 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; Domain 6
Homologous superfamily homologous superfamily	10 — DNA-directed RNA polymerase, subunit 2, domain 6

Domain ID domain_id	3h0gB07
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	150 — RNA polymerase II, Rpb2 subunit, wall domain

Domain ID domain_id	3h0gB08
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1800 — DCoH-like
Homologous superfamily homologous superfamily	10 — RNA polymerase alpha subunit dimerisation domain

Domain ID domain_id	3h0gC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	3h0gC02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	3h0gD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	40 — RNA Polymerase II, Rpb4 subunit

Domain ID domain_id	3h0gE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1340 — Dna-directed Rna Polymerases I, Ii, And Iii 27 Kd Polypeptide; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — RNA polymerase, Rpb5, N-terminal domain

Domain ID domain_id	3h0gE02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	3h0gF00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	3h0gG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	120 — RNA polymerase Rpb7-like, N-terminal domain

Domain ID domain_id	3h0gG02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	3h0gH00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	3h0gI01
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3h0gI02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3h0gJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	3h0gK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	3h0gL00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

Domain ID domain_id	3h0gM03
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	40 — Barwin-like endoglucanases
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	3h0gM04
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	180 — RNA polymerase ii

Domain ID domain_id	3h0gM05
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	274 — Enzyme I; Chain A, domain 2
Homologous superfamily homologous superfamily	100 — RNA polymerase Rpb1, domain 3

Domain ID domain_id	3h0gM06
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	132 — Topoisomerase I; Chain A, domain 4
Homologous superfamily homologous superfamily	30 — RNA polymerase Rpb1 funnel domain

Domain ID domain_id	3h0gM10
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	140 —

Domain ID domain_id	3h0gN04
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	3h0gN05
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1070 — Hypothetical Protein Ta0175; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	3h0gN06
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	270 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; Domain 6
Homologous superfamily homologous superfamily	10 — DNA-directed RNA polymerase, subunit 2, domain 6

Domain ID domain_id	3h0gN07
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	150 — RNA polymerase II, Rpb2 subunit, wall domain

Domain ID domain_id	3h0gN08
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1800 — DCoH-like
Homologous superfamily homologous superfamily	10 — RNA polymerase alpha subunit dimerisation domain

Domain ID domain_id	3h0gO01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	3h0gO02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	3h0gP00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	40 — RNA Polymerase II, Rpb4 subunit

Domain ID domain_id	3h0gQ01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1340 — Dna-directed Rna Polymerases I, Ii, And Iii 27 Kd Polypeptide; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — RNA polymerase, Rpb5, N-terminal domain

Domain ID domain_id	3h0gQ02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	3h0gR00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	3h0gS01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	120 — RNA polymerase Rpb7-like, N-terminal domain

Domain ID domain_id	3h0gS02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	3h0gT00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	3h0gU01
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3h0gU02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3h0gV00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	3h0gW00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	3h0gX00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

▶

Unit-cell length a length_a	163.034 Å
Unit-cell length b length_b	202.684 Å
Unit-cell length c length_c	391.258 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.650 Å
Low-resolution limit resolution_low	48.695 Å
R factor r_factor	0.2970
R_work r_work	0.2970
R_free r_free	0.3210

RNA Polymerase II from Schizosaccharomyces pombe

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit rpb1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit rpb4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit rpb7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer