SAXSdb — 3j2u

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinesin-like protein Klp10A

Drosophila melanogaster

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 210	Tubulin alpha-1A chain × 84 （P81947） Tubulin beta-2B chain × 84 （Q6B856）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Tubulin alpha-1A chain × 2 （P81947） Tubulin beta-2B chain × 2 （Q6B856）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Tubulin alpha-1A chain × 2 （P81947） Tubulin beta-2B chain × 2 （Q6B856）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KI10A_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain K； PDBConstruct 38–374； UniProt 279–615

Tubulin alpha-1A chain

OrganismNot specified

UniProt P81947

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 210	Kinesin-like protein Klp10A × 42 （Q960Z0） Tubulin beta-2B chain × 84 （Q6B856）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Kinesin-like protein Klp10A × 1 （Q960Z0） Tubulin beta-2B chain × 2 （Q6B856）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Kinesin-like protein Klp10A × 1 （Q960Z0） Tubulin beta-2B chain × 2 （Q6B856）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1B_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–451； UniProt 1–451 Author chain C； PDBConstruct 1–451； UniProt 1–451

Tubulin beta-2B chain

OrganismNot specified

UniProt Q6B856

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 210	Kinesin-like protein Klp10A × 42 （Q960Z0） Tubulin alpha-1A chain × 84 （P81947）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Kinesin-like protein Klp10A × 1 （Q960Z0） Tubulin alpha-1A chain × 2 （P81947）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Kinesin-like protein Klp10A × 1 （Q960Z0） Tubulin alpha-1A chain × 2 （P81947）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB2B_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–445； UniProt 1–445 Author chain D； PDBConstruct 1–445； UniProt 1–445

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3j2u
Deposition date deposition_date	2013-01-10
Structure title title	Kinesin-13 KLP10A HD in complex with CS-tubulin and a microtubule
Keywords keywords	tubulin, kinesin, kinesin-13, KinI, depolymerase, depolymerization, microtubule, Kinesin13, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3j2u__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3j2u__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3j2u__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	186.90 Å
Total Rg	186.90 Å
Atom count	654150
Residues	83370
Excluded volume	11594000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3j2u__assembly_1__model_1`	210-meric （210）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3j2u__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`3j2u__assembly_3__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Kinesin-like protein Klp10A
Molecular weight formula_weight	41810.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K
Atom count atom_count	15575

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRSITVCVRKRPISRKEVNRKEIDVISVPRKDMLIVHEPRSKVDLTKFLENHKFRFDYAFNDTCDNAMVYKYTAKPLVKTIFEGGMATCFAYGQTGSGKTHTMGGEFNGKVQDCKNGIYAMAAKDVFVTLNMPRYRAMNLVVSASFFEIYSGKVFDLLSDKQKLRVLEDGKQQVQVVGLTEKVVDGVEEVLKLIQHGNAARTSGQTSANSNSSRSHAVFQIVLRPQGSTKIHGKFSFIDLAGNERGVDTSSADRQTRMEGAEINKSLLALKECIRALGKQSAHLPFRVSKLTQVLRDSFIGEKSKTCMIAMISPGLSSCEHTLNTLRYADRVKELVVKDI

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	Fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	50107.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 3 Entity 3 polymer

Description description	Tubulin beta-2B chain
Molecular weight formula_weight	49907.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	10.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	54584

Kinesin-13 KLP10A HD in complex with CS-tubulin and a microtubule

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinesin-like protein Klp10A

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin beta-2B chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3j2u__assembly_1__model_1

3j2u__assembly_1__model_1 | I(q)

3j2u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Kinesin-13 KLP10A HD in complex with CS-tubulin and a microtubule

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinesin-like protein Klp10A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-2B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3j2u__assembly_1__model_1

3j2u__assembly_1__model_1 | I(q)

3j2u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)