SAXSdb — 3jc1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Increased Sodium Tolerance 1 (IST1)

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 68	Charged multivesicular body protein 1b × 34 （Q7LBR1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IST1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–182； UniProt 6–187 Author chain Ac； PDBConstruct 1–182； UniProt 6–187 Author chain Ae； PDBConstruct 1–182； UniProt 6–187 Author chain Ag； PDBConstruct 1–182； UniProt 6–187 Author chain Ai； PDBConstruct 1–182； UniProt 6–187 Author chain Ak； PDBConstruct 1–182； UniProt 6–187 Author chain Am； PDBConstruct 1–182； UniProt 6–187 Author chain Ao； PDBConstruct 1–182； UniProt 6–187 Author chain Aq； PDBConstruct 1–182； UniProt 6–187 Author chain As； PDBConstruct 1–182； UniProt 6–187 Author chain Au； PDBConstruct 1–182； UniProt 6–187 Author chain Aw； PDBConstruct 1–182； UniProt 6–187 Author chain Ay； PDBConstruct 1–182； UniProt 6–187 Author chain Ba； PDBConstruct 1–182； UniProt 6–187 Author chain Bc； PDBConstruct 1–182； UniProt 6–187 Author chain Be； PDBConstruct 1–182； UniProt 6–187 Author chain Bg； PDBConstruct 1–182； UniProt 6–187 Author chain Bi； PDBConstruct 1–182； UniProt 6–187 Author chain Bk； PDBConstruct 1–182； UniProt 6–187 Author chain Bm； PDBConstruct 1–182； UniProt 6–187 Author chain Bo； PDBConstruct 1–182； UniProt 6–187 Author chain Bq； PDBConstruct 1–182； UniProt 6–187 Author chain Bs； PDBConstruct 1–182； UniProt 6–187 Author chain Bu； PDBConstruct 1–182； UniProt 6–187 Author chain Bw； PDBConstruct 1–182； UniProt 6–187 Author chain By； PDBConstruct 1–182； UniProt 6–187 Author chain Ca； PDBConstruct 1–182； UniProt 6–187 Author chain Cc； PDBConstruct 1–182； UniProt 6–187 Author chain Ce； PDBConstruct 1–182； UniProt 6–187 Author chain Cg； PDBConstruct 1–182； UniProt 6–187 Author chain Ci； PDBConstruct 1–182； UniProt 6–187 Author chain Ck； PDBConstruct 1–182； UniProt 6–187 Author chain Cm； PDBConstruct 1–182； UniProt 6–187 Author chain Co； PDBConstruct 1–182； UniProt 6–187

Charged multivesicular body protein 1b

Homo sapiens

UniProt Q7LBR1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 68	Increased Sodium Tolerance 1 (IST1) × 34 （P53990）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHM1B_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–160； UniProt 4–163 Author chain Ad； PDBConstruct 1–160； UniProt 4–163 Author chain Af； PDBConstruct 1–160； UniProt 4–163 Author chain Ah； PDBConstruct 1–160； UniProt 4–163 Author chain Aj； PDBConstruct 1–160； UniProt 4–163 Author chain Al； PDBConstruct 1–160； UniProt 4–163 Author chain An； PDBConstruct 1–160； UniProt 4–163 Author chain Ap； PDBConstruct 1–160； UniProt 4–163 Author chain Ar； PDBConstruct 1–160； UniProt 4–163 Author chain At； PDBConstruct 1–160； UniProt 4–163 Author chain Av； PDBConstruct 1–160； UniProt 4–163 Author chain Ax； PDBConstruct 1–160； UniProt 4–163 Author chain Az； PDBConstruct 1–160； UniProt 4–163 Author chain Bb； PDBConstruct 1–160； UniProt 4–163 Author chain Bd； PDBConstruct 1–160； UniProt 4–163 Author chain Bf； PDBConstruct 1–160； UniProt 4–163 Author chain Bh； PDBConstruct 1–160； UniProt 4–163 Author chain Bj； PDBConstruct 1–160； UniProt 4–163 Author chain Bl； PDBConstruct 1–160； UniProt 4–163 Author chain Bn； PDBConstruct 1–160； UniProt 4–163 Author chain Bp； PDBConstruct 1–160； UniProt 4–163 Author chain Br； PDBConstruct 1–160； UniProt 4–163 Author chain Bt； PDBConstruct 1–160； UniProt 4–163 Author chain Bv； PDBConstruct 1–160； UniProt 4–163 Author chain Bx； PDBConstruct 1–160； UniProt 4–163 Author chain Bz； PDBConstruct 1–160； UniProt 4–163 Author chain Cb； PDBConstruct 1–160； UniProt 4–163 Author chain Cd； PDBConstruct 1–160； UniProt 4–163 Author chain Cf； PDBConstruct 1–160； UniProt 4–163 Author chain Ch； PDBConstruct 1–160； UniProt 4–163 Author chain Cj； PDBConstruct 1–160； UniProt 4–163 Author chain Cl； PDBConstruct 1–160； UniProt 4–163 Author chain Cn； PDBConstruct 1–160； UniProt 4–163 Author chain Cp； PDBConstruct 1–160； UniProt 4–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3jc1
Deposition date deposition_date	2015-11-09
Structure title title	Electron cryo-microscopy of the IST1-CHMP1B ESCRT-III copolymer
Keywords keywords	ESCRT-III, IST1, CHMP1B, membrane tubulation, helical filament, LIPID BINDING PROTEIN; LIPID BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3jc1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3jc1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3jc1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	97.75 Å
Rg (electron density)	96.97 Å
Total Rg	96.89 Å
Atom count	92106
Residues	11628
Excluded volume	1657800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3jc1__assembly_1__model_1`	68-meric （68）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Increased Sodium Tolerance 1 (IST1)
Molecular weight formula_weight	20934.5 kDa
Source method src_method	man
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ac,Ae,Ag,Ai,Ak,Am,Ao,Aq,As,Au,Aw,Ay,Ba,Bc,Be,Bg,Bi,Bk,Bm,Bo,Bq,Bs,Bu,Bw,By,Ca,Cc,Ce,Cg,Ci,Ck,Cm,Co
Atom count atom_count	92106

FKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Charged multivesicular body protein 1b
Molecular weight formula_weight	17937.7 kDa
Source method src_method	man
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab,Ad,Af,Ah,Aj,Al,An,Ap,Ar,At,Av,Ax,Az,Bb,Bd,Bf,Bh,Bj,Bl,Bn,Bp,Br,Bt,Bv,Bx,Bz,Cb,Cd,Cf,Ch,Cj,Cl,Cn,Cp

MEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIEKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	Iterative Helical Real Space Reconstruction (IHRSR)
颗粒数 num_particles	188713

Electron cryo-microscopy of the IST1-CHMP1B ESCRT-III copolymer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Increased Sodium Tolerance 1 (IST1)

State in the Current Structure

Other States of the Same Protein in the Database

Charged multivesicular body protein 1b

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3jc1__assembly_1__model_1

3jc1__assembly_1__model_1 | I(q)

3jc1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Electron cryo-microscopy of the IST1-CHMP1B ESCRT-III copolymer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Increased Sodium Tolerance 1 (IST1)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Charged multivesicular body protein 1b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3jc1__assembly_1__model_1

3jc1__assembly_1__model_1 | I(q)

3jc1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)