SAXSdb — 6e8g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

IST1 homolog

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	Charged multivesicular body protein 1b × 36 （Q7LBR1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IST1_HUMAN
Isoform	P53990-4
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–366； UniProt 1–366 Author chain BA； PDBConstruct 1–366； UniProt 1–366 Author chain BB； PDBConstruct 1–366； UniProt 1–366 Author chain C； PDBConstruct 1–366； UniProt 1–366 Author chain DA； PDBConstruct 1–366； UniProt 1–366 Author chain DB； PDBConstruct 1–366； UniProt 1–366 Author chain E； PDBConstruct 1–366； UniProt 1–366 Author chain FA； PDBConstruct 1–366； UniProt 1–366 Author chain FB； PDBConstruct 1–366； UniProt 1–366 Author chain G； PDBConstruct 1–366； UniProt 1–366 Author chain HA； PDBConstruct 1–366； UniProt 1–366 Author chain HB； PDBConstruct 1–366； UniProt 1–366 Author chain I； PDBConstruct 1–366； UniProt 1–366 Author chain JA； PDBConstruct 1–366； UniProt 1–366 Author chain JB； PDBConstruct 1–366； UniProt 1–366 Author chain K； PDBConstruct 1–366； UniProt 1–366 Author chain LA； PDBConstruct 1–366； UniProt 1–366 Author chain LB； PDBConstruct 1–366； UniProt 1–366 Author chain M； PDBConstruct 1–366； UniProt 1–366 Author chain NA； PDBConstruct 1–366； UniProt 1–366 Author chain NB； PDBConstruct 1–366； UniProt 1–366 Author chain O； PDBConstruct 1–366； UniProt 1–366 Author chain PA； PDBConstruct 1–366； UniProt 1–366 Author chain PB； PDBConstruct 1–366； UniProt 1–366 Author chain Q； PDBConstruct 1–366； UniProt 1–366 Author chain RA； PDBConstruct 1–366； UniProt 1–366 Author chain RB； PDBConstruct 1–366； UniProt 1–366 Author chain S； PDBConstruct 1–366； UniProt 1–366 Author chain TA； PDBConstruct 1–366； UniProt 1–366 Author chain TB； PDBConstruct 1–366； UniProt 1–366 Author chain V； PDBConstruct 1–366； UniProt 1–366 Author chain VA； PDBConstruct 1–366； UniProt 1–366 Author chain X； PDBConstruct 1–366； UniProt 1–366 Author chain XA； PDBConstruct 1–366； UniProt 1–366 Author chain Z； PDBConstruct 1–366； UniProt 1–366 Author chain ZA； PDBConstruct 1–366； UniProt 1–366

Charged multivesicular body protein 1b

Homo sapiens

UniProt Q7LBR1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	IST1 homolog × 36 （P53990）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHM1B_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AA； PDBConstruct 1–199； UniProt 1–199 Author chain AB； PDBConstruct 1–199； UniProt 1–199 Author chain B； PDBConstruct 1–199； UniProt 1–199 Author chain CA； PDBConstruct 1–199； UniProt 1–199 Author chain CB； PDBConstruct 1–199； UniProt 1–199 Author chain D； PDBConstruct 1–199； UniProt 1–199 Author chain EA； PDBConstruct 1–199； UniProt 1–199 Author chain EB； PDBConstruct 1–199； UniProt 1–199 Author chain F； PDBConstruct 1–199； UniProt 1–199 Author chain GA； PDBConstruct 1–199； UniProt 1–199 Author chain GB； PDBConstruct 1–199； UniProt 1–199 Author chain H； PDBConstruct 1–199； UniProt 1–199 Author chain IA； PDBConstruct 1–199； UniProt 1–199 Author chain IB； PDBConstruct 1–199； UniProt 1–199 Author chain J； PDBConstruct 1–199； UniProt 1–199 Author chain KA； PDBConstruct 1–199； UniProt 1–199 Author chain KB； PDBConstruct 1–199； UniProt 1–199 Author chain L； PDBConstruct 1–199； UniProt 1–199 Author chain MA； PDBConstruct 1–199； UniProt 1–199 Author chain MB； PDBConstruct 1–199； UniProt 1–199 Author chain N； PDBConstruct 1–199； UniProt 1–199 Author chain OA； PDBConstruct 1–199； UniProt 1–199 Author chain OB； PDBConstruct 1–199； UniProt 1–199 Author chain P； PDBConstruct 1–199； UniProt 1–199 Author chain QA； PDBConstruct 1–199； UniProt 1–199 Author chain QB； PDBConstruct 1–199； UniProt 1–199 Author chain R； PDBConstruct 1–199； UniProt 1–199 Author chain SA； PDBConstruct 1–199； UniProt 1–199 Author chain SB； PDBConstruct 1–199； UniProt 1–199 Author chain T； PDBConstruct 1–199； UniProt 1–199 Author chain UA； PDBConstruct 1–199； UniProt 1–199 Author chain UB； PDBConstruct 1–199； UniProt 1–199 Author chain W； PDBConstruct 1–199； UniProt 1–199 Author chain WA； PDBConstruct 1–199； UniProt 1–199 Author chain Y； PDBConstruct 1–199； UniProt 1–199 Author chain YA； PDBConstruct 1–199； UniProt 1–199

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6e8g
Deposition date deposition_date	2018-07-29
Structure title title	CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom resolution
Keywords keywords	ESCRT-III, CHMP1B, IST1, ssDNA, DNA BINDING PROTEIN, PROTEIN FIBRIL; DNA BINDING PROTEIN, PROTEIN FIBRIL
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6e8g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6e8g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6e8g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	97.98 Å
Rg (electron density)	96.97 Å
Total Rg	96.76 Å
Atom count	97272
Residues	12276
Excluded volume	1747000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6e8g__assembly_1__model_1`	72-meric （72）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	IST1 homolog
Molecular weight formula_weight	40024.7 kDa
Source method src_method	man
Copy count entity_count	36

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,A,C,E,G,I,K,M,O,Q,V,X,Z,BA,DA,FA,HA,JA,LA,NA,PA,RA,TA,VA,XA,ZA,BB,DB,FB,HB,JB,LB,NB,PB,RB,TB
Atom count atom_count	97272

MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKKT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Charged multivesicular body protein 1b
Molecular weight formula_weight	22140.4 kDa
Mutation mutation	K37E
Source method src_method	man
Copy count entity_count	36

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,B,D,F,H,J,L,N,P,R,W,Y,AA,CA,EA,GA,IA,KA,MA,OA,QA,SA,UA,WA,YA,AB,CB,EB,GB,IB,KB,MB,OB,QB,SB,UB

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIEKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	101990

CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

IST1 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Charged multivesicular body protein 1b

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6e8g__assembly_1__model_1

6e8g__assembly_1__model_1 | I(q)

6e8g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

IST1 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Charged multivesicular body protein 1b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6e8g__assembly_1__model_1

6e8g__assembly_1__model_1 | I(q)

6e8g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)