SAXSdb — 3k6g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Telomeric repeat-binding factor 2-interacting protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Telomeric repeat-binding factor 2 × 1 （Q15554） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Telomeric repeat-binding factor 2 × 1 （Q15554） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Telomeric repeat-binding factor 2 × 1 （Q15554） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TE2IP_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–98； UniProt 303–399 Author chain B； PDBConstruct 2–98； UniProt 303–399 Author chain C； PDBConstruct 2–98； UniProt 303–399

Telomeric repeat-binding factor 2

Homo sapiens

UniProt Q15554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Telomeric repeat-binding factor 2-interacting protein 1 × 1 （Q9NYB0） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Telomeric repeat-binding factor 2-interacting protein 1 × 1 （Q9NYB0） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Telomeric repeat-binding factor 2-interacting protein 1 × 1 （Q9NYB0） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TERF2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–42； UniProt 275–316 Author chain E； PDBConstruct 1–42； UniProt 275–316 Author chain F； PDBConstruct 1–42； UniProt 275–316

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3k6g
Deposition date deposition_date	2009-10-08
Structure title title	Crystal structure of Rap1 and TRF2 complex
Keywords keywords	helix, Chromosomal protein, Nucleus, Phosphoprotein, Telomere, Cell cycle, DNA-binding, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3k6g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3k6g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3k6g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.77 Å
Rg (electron density)	14.60 Å
Total Rg	15.68 Å
Atom count	981
Residues	123
Excluded volume	17521 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3k6g__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3k6g__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3k6g__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Telomeric repeat-binding factor 2-interacting protein 1
Molecular weight formula_weight	12110.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	3184

SEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKKGGSGGSGGSGGKL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Telomeric repeat-binding factor 2
Molecular weight formula_weight	4617.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

QLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	225

▶

Unit-cell length a length_a	42.568 Å
Unit-cell length b length_b	72.105 Å
Unit-cell length c length_c	150.993 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.950 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	—
R_work r_work	0.2242
R_free r_free	0.2356

Crystal structure of Rap1 and TRF2 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Telomeric repeat-binding factor 2-interacting protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Telomeric repeat-binding factor 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3k6g__assembly_1__model_1

3k6g__assembly_1__model_1 | I(q)

3k6g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of Rap1 and TRF2 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Telomeric repeat-binding factor 2-interacting protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomeric repeat-binding factor 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3k6g__assembly_1__model_1

3k6g__assembly_1__model_1 | I(q)

3k6g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)