3kzi

Crystal Structure of Monomeric Form of Cyanobacterial Photosystem II

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem Q(B) protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA1_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–344； UniProt 1–344

Photosystem II core light harvesting protein

OrganismNot specified

UniProt Q8DIQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DIQ1_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–510； UniProt 1–510

Photosystem II CP43 protein

OrganismNot specified

UniProt Q8DIF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DIF8_THEEB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–461； UniProt 1–461

Photosystem II D2 protein

OrganismNot specified

UniProt Q8CM25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_THEEB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 1–352

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt Q8DIP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_THEEB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–83； UniProt 2–84

Cytochrome b559 subunit beta

OrganismNot specified

UniProt Q8DIN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_THEEB
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–44； UniProt 2–45

Photosystem II reaction center protein H

OrganismNot specified

UniProt Q8DJ43

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_THEEB
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–65； UniProt 2–66

Photosystem II reaction center protein I

OrganismNot specified

UniProt Q8DJZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_THEEB
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein J

OrganismNot specified

UniProt P59087

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_THEEB
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40

Photosystem II reaction center protein K

OrganismNot specified

UniProt Q9F1K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_THEEB
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 10–46

Photosystem II reaction center protein L

OrganismNot specified

UniProt Q8DIN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_THEEB
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein M

OrganismNot specified

UniProt Q8DHA7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_THEEB
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–36； UniProt 1–36

Photosystem II manganese-stabilizing polypeptide

OrganismNot specified

UniProt P0A431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO_THEEB
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–246； UniProt 27–272

Photosystem II reaction center protein T

OrganismNot specified

UniProt Q8DIQ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_THEEB
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain T； PDBConstruct 1–32； UniProt 1–32

Photosystem II 12 kDa extrinsic protein

OrganismNot specified

UniProt Q9F1L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBU_THEEB
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain U； PDBConstruct 1–104； UniProt 31–134

Cytochrome c-550

OrganismNot specified

UniProt P0A386

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY550_THEEB
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain V； PDBConstruct 1–137； UniProt 27–163

Photosystem II reaction center protein ycf12

OrganismNot specified

UniProt Q8DJI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YCF12_THEEB
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain y； PDBConstruct 1–46； UniProt 1–46

Photosystem II reaction center X protein

OrganismNot specified

UniProt Q9F1R6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBX_THEEB
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain X； PDBConstruct 1–40； UniProt 2–41

Photosystem II reaction center protein Z

OrganismNot specified

UniProt Q8DHJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem Q(B) protein 1 × 1 （P0A444） Photosystem II core light harvesting protein × 1 （Q8DIQ1） Photosystem II CP43 protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein J × 1 （P59087） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 1 （P0A431） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 1 （Q9F1L5） Cytochrome c-550 × 1 （P0A386） Photosystem II reaction center protein ycf12 × 1 （Q8DJI1） Photosystem II reaction center X protein × 1 （Q9F1R6） FE (II) ION × 1 CHLOROPHYLL A × 35 PHEOPHYTIN A × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 OXYGEN EVOLVING SYSTEM × 1 BETA-CAROTENE × 11 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 DODECYL-BETA-D-MALTOSIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 BICARBONATE ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_THEEB
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3kzi
Deposition date deposition_date	2009-12-08
Structure title title	Crystal Structure of Monomeric Form of Cyanobacterial Photosystem II
Keywords keywords	;ELECTRON TRANSPORT PHOTOSYSTEM, PS II, PS2, MEMBRANE COMPLEX, TRANSMEMBRANE ALPHA-HELIX, IRON, METAL-BINDING, PHOTOSYNTHESIS, PHOTOSYSTEM II, THYLAKOID, HEME, REACTION CENTER, MANGANESE, ELECTRON TRANSPORT ;; ELECTRON TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3kzi__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3kzi__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3kzi__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.69 Å
Rg (electron density)	41.67 Å
Total Rg	42.22 Å
Atom count	24678
Residues	2597
Excluded volume	458790 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3kzi__assembly_1__model_1`	nonadecameric （19）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (34)

Entity 1 Entity 1 polymer

Description description	Photosystem Q(B) protein 1
Molecular weight formula_weight	38265.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	24678

MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA

Entity 2 Entity 2 polymer

Description description	Photosystem II core light harvesting protein
Molecular weight formula_weight	56656.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRRKEAV

Entity 3 Entity 3 polymer

Description description	Photosystem II CP43 protein
Molecular weight formula_weight	50287.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD

Entity 4 Entity 4 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39388.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9449.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	4936.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

TSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

Entity 7 Entity 7 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7227.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4410.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	4105.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	4101.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4299.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3981.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS

Entity 13 Entity 13 polymer

Description description	Photosystem II manganese-stabilizing polypeptide
Molecular weight formula_weight	26852.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

AKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3878.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

METITYVFIFACIIALFFFAIFFREPPRITKK

Entity 15 Entity 15 polymer

Description description	Photosystem II 12 kDa extrinsic protein
Molecular weight formula_weight	11656.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

ATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK

Entity 16 Entity 16 polymer

Description description	Cytochrome c-550
Molecular weight formula_weight	15148.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY

Entity 17 Entity 17 polymer

Description description	Photosystem II reaction center protein ycf12
Molecular weight formula_weight	5039.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MGIFNGIIEFLSNINFEVIAQLTMIAMIGIAGPMIIFLLAVRRGNL

Entity 18 Entity 18 polymer

Description description	Photosystem II reaction center X protein
Molecular weight formula_weight	4191.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL

Entity 19 Entity 19 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6766.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV

Entity 20 Entity 20 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	35

Entity 22 Entity 22 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Molecular weight formula_weight	195.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 24 Entity 24 non-polymer

Description description	OXYGEN EVOLVING SYSTEM
Molecular weight formula_weight	323.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 25 Entity 25 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 26 Entity 26 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 28 Entity 28 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 29 Entity 29 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 30 Entity 30 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 31 Entity 31 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 32 Entity 32 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

Domain ID domain_id	3kziB02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	680 — Photosystem II CP47 reaction center protein
Homologous superfamily homologous superfamily	10 — Photosystem II CP47 reaction center protein

Domain ID domain_id	3kziC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	670 — photosystem ii from thermosynechococcus elongatus

Domain ID domain_id	3kziE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	3kziH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	880 — Photosystem II reaction center protein H

Domain ID domain_id	3kziO01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	30 — Photosystem II, cytochrome c-550 precursor

Domain ID domain_id	3kziO02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2050 — photosynthetic oxygen evolving center fold
Homologous superfamily homologous superfamily	10 — photosynthetic oxygen evolving center domain

Domain ID domain_id	3kziU01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	320 — Photosystem II 12 kDa extrinsic protein

Domain ID domain_id	3kziV00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	3kziZ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	740 — Photosystem II PsbZ, reaction centre

▶

Unit-cell length a length_a	119.890 Å
Unit-cell length b length_b	224.690 Å
Unit-cell length c length_c	337.280 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	3.600 Å
Low-resolution limit resolution_low	29.870 Å
R factor r_factor	0.2970
R_work r_work	0.2970
R_free r_free	0.3080

Crystal Structure of Monomeric Form of Cyanobacterial Photosystem II

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem Q(B) protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II core light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer