1izl

Crystal Structure of Photosystem II

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II: Subunit PsbA

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Photosystem II: Subunit PsbB × 2 Photosystem II: Subunit PsbC × 2 Photosystem II: Subunit PsbD × 2 Photosystem II: Subunit PsbE × 2 Photosystem II: Subunit PsbF × 2 Photosystem II: Subunit PsbG × 2 Photosystem II: Subunit PsbH × 2 Photosystem II: Subunit PsbI × 2 Photosystem II: Subunit PsbK × 2 （Q9F1K9） Photosystem II: Subunit PsbO × 2 Photosystem II: Subunit PsbU × 2 Photosystem II: Subunit PsbV × 2 （P56150） Photosystem II: Subunit PsbX × 2 MANGANESE (II) ION × 8 CHLOROPHYLL A × 72 PHEOPHYTIN A × 4 FE (III) ION × 2 2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYL)-AMINO]-2-METHYL-SUCCINIC ACID × 2 BETA-CAROTENE × 2 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_SYNVU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–360； UniProt 1–360 Author chain J； PDBConstruct 1–360； UniProt 1–360

Photosystem II: Subunit PsbK

OrganismNot specified

UniProt Q9F1K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Photosystem II: Subunit PsbA × 2 （P51765） Photosystem II: Subunit PsbB × 2 Photosystem II: Subunit PsbC × 2 Photosystem II: Subunit PsbD × 2 Photosystem II: Subunit PsbE × 2 Photosystem II: Subunit PsbF × 2 Photosystem II: Subunit PsbG × 2 Photosystem II: Subunit PsbH × 2 Photosystem II: Subunit PsbI × 2 Photosystem II: Subunit PsbO × 2 Photosystem II: Subunit PsbU × 2 Photosystem II: Subunit PsbV × 2 （P56150） Photosystem II: Subunit PsbX × 2 MANGANESE (II) ION × 8 CHLOROPHYLL A × 72 PHEOPHYTIN A × 4 FE (III) ION × 2 2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYL)-AMINO]-2-METHYL-SUCCINIC ACID × 2 BETA-CAROTENE × 2 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_SYNEL
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 10–46 Author chain W； PDBConstruct 1–37； UniProt 10–46

Photosystem II: Subunit PsbV

OrganismNot specified

UniProt P56150

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Photosystem II: Subunit PsbA × 2 （P51765） Photosystem II: Subunit PsbB × 2 Photosystem II: Subunit PsbC × 2 Photosystem II: Subunit PsbD × 2 Photosystem II: Subunit PsbE × 2 Photosystem II: Subunit PsbF × 2 Photosystem II: Subunit PsbG × 2 Photosystem II: Subunit PsbH × 2 Photosystem II: Subunit PsbI × 2 Photosystem II: Subunit PsbK × 2 （Q9F1K9） Photosystem II: Subunit PsbO × 2 Photosystem II: Subunit PsbU × 2 Photosystem II: Subunit PsbX × 2 MANGANESE (II) ION × 8 CHLOROPHYLL A × 72 PHEOPHYTIN A × 4 FE (III) ION × 2 2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYL)-AMINO]-2-METHYL-SUCCINIC ACID × 2 BETA-CAROTENE × 2 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C550_SYNEL
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 0； PDBConstruct 1–137； UniProt 27–163 Author chain V； PDBConstruct 1–137； UniProt 27–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1izl
Deposition date deposition_date	2002-10-04
Structure title title	Crystal Structure of Photosystem II
Keywords keywords	;Photosynthesis, Photosynthetic reaction center, Core-antenna, Thermophilic cyanobacterium, Membrane protein complex, Electron transfer, Energy transfer ;; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1izl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1izl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1izl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.52 Å
Rg (electron density)	56.32 Å
Total Rg	57.92 Å
Atom count	22268
Residues	3761
Excluded volume	486200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1izl__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	Photosystem II: Subunit PsbA
Molecular weight formula_weight	39792.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,J
Atom count atom_count	22804

MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLASAESAPVAMIAPSING

Entity 2 Entity 2 polymer

Description description	Photosystem II: Subunit PsbB
Molecular weight formula_weight	49478.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,L

MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRRKEAV

Entity 3 Entity 3 polymer

Description description	Photosystem II: Subunit PsbC
Molecular weight formula_weight	49868.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,M

MKTLSSQKRYSPVVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD

Entity 4 Entity 4 polymer

Description description	Photosystem II: Subunit PsbD
Molecular weight formula_weight	39388.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,N

MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	Photosystem II: Subunit PsbE
Molecular weight formula_weight	9449.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

Entity 6 Entity 6 polymer

Description description	Photosystem II: Subunit PsbF
Molecular weight formula_weight	4936.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

TSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

Entity 7 Entity 7 polymer

Description description	Photosystem II: Subunit PsbG
Molecular weight formula_weight	18741.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 8 Entity 8 polymer

Description description	Photosystem II: Subunit PsbH
Molecular weight formula_weight	2826.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 9 Entity 9 polymer

Description description	Photosystem II: Subunit PsbI
Molecular weight formula_weight	2230.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T

XXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	Photosystem II: Subunit PsbK
Molecular weight formula_weight	4101.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR

Entity 11 Entity 11 polymer

Description description	Photosystem II: Subunit PsbO
Molecular weight formula_weight	17464.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,Y

Entity 12 Entity 12 polymer

Description description	Photosystem II: Subunit PsbU
Molecular weight formula_weight	8273.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 13 Entity 13 polymer

Description description	Photosystem II: Subunit PsbV
Molecular weight formula_weight	15148.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,0

AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY

Entity 14 Entity 14 polymer

Description description	Photosystem II: Subunit PsbX
Molecular weight formula_weight	2145.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,1

XXXXXXXXXXXXXXXXXXXXXXXXX

Entity 15 Entity 15 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 16 Entity 16 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	72

Entity 17 Entity 17 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 18 Entity 18 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYL)-AMINO]-2-METHYL-SUCCINIC ACID
Molecular weight formula_weight	378.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 20 Entity 20 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 30 domains

SCOP 2.08 (28 domains)

Domain ID domain_id	d1izl0_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izl1_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izla_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlb_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlc_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izld_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izle_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlf_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlg_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlh_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izli_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlj_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlk_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izll_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlm_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izln_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlo_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlp_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlq_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlr_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izls_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlt_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlu_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlv_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlw_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlx_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izly_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

Domain ID domain_id	d1izlz_
Class class	i — Low resolution protein structures
Fold Fold fold	i.5 — Photosystems
Superfamily Superfamily superfamily	i.5.1 — Photosystems
Family Family family	i.5.1.1 — Photosystems

CATH v4.4 (2 domains)

Domain ID domain_id	1izl000
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	1izlV00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

▶

Unit-cell length a length_a	129.377 Å
Unit-cell length b length_b	225.192 Å
Unit-cell length c length_c	308.672 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.700 Å
Low-resolution limit resolution_low	25.000 Å
R factor r_factor	0.5304
R_work r_work	0.5304
R_free r_free	—

Crystal Structure of Photosystem II

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II: Subunit PsbA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II: Subunit PsbK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II: Subunit PsbV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1izl__assembly_1__model_1

1izl__assembly_1__model_1 | I(q)

1izl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

Entity 15 Entity 15 non-polymer

Entity 16 Entity 16 non-polymer

Entity 17 Entity 17 non-polymer

Entity 18 Entity 18 non-polymer

Entity 19 Entity 19 non-polymer

Entity 20 Entity 20 non-polymer

Entity 21 Entity 21 non-polymer

6. Fold Classification (SCOP + CATH) 30 domains

SCOP 2.08 (28 domains)

CATH v4.4 (2 domains)

7. Citations (1)