3a0b

Crystal structure of Br-substituted Photosystem II complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem Q(B) protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II core light harvesting protein × 2 Photosystem II CP43 protein × 2 Photosystem II D2 protein × 2 Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 Photosystem II reaction center protein I × 2 Photosystem II reaction center protein J × 2 （Q7DGD4） Photosystem II reaction center protein K × 2 Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 Photosystem II manganese-stabilizing polypeptide × 2 Photosystem II reaction center protein T × 2 （P12313） Photosystem II 12 kDa extrinsic protein × 2 Cytochrome c-550 × 2 （P0A387） Photosystem II reaction center protein X × 2 Photosystem II reaction center protein ycf12 × 2 Photosystem II reaction center protein Y × 2 Photosystem II reaction center protein Z × 2 OXYGEN EVOLVING SYSTEM × 2 FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 BROMIDE ION × 4 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_THEVL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–344； UniProt 1–344 Author chain a； PDBConstruct 1–344； UniProt 1–344

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P12238

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem Q(B) protein × 2 （P51765） Photosystem II core light harvesting protein × 2 Photosystem II CP43 protein × 2 Photosystem II D2 protein × 2 Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 Photosystem II reaction center protein I × 2 Photosystem II reaction center protein J × 2 （Q7DGD4） Photosystem II reaction center protein K × 2 Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 Photosystem II manganese-stabilizing polypeptide × 2 Photosystem II reaction center protein T × 2 （P12313） Photosystem II 12 kDa extrinsic protein × 2 Cytochrome c-550 × 2 （P0A387） Photosystem II reaction center protein X × 2 Photosystem II reaction center protein ycf12 × 2 Photosystem II reaction center protein Y × 2 Photosystem II reaction center protein Z × 2 OXYGEN EVOLVING SYSTEM × 2 FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 BROMIDE ION × 4 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_THEVL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–83； UniProt 2–84 Author chain e； PDBConstruct 1–83； UniProt 2–84

Cytochrome b559 subunit beta

OrganismNot specified

UniProt P12239

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem Q(B) protein × 2 （P51765） Photosystem II core light harvesting protein × 2 Photosystem II CP43 protein × 2 Photosystem II D2 protein × 2 Cytochrome b559 subunit alpha × 2 （P12238） Photosystem II reaction center protein H × 2 Photosystem II reaction center protein I × 2 Photosystem II reaction center protein J × 2 （Q7DGD4） Photosystem II reaction center protein K × 2 Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 Photosystem II manganese-stabilizing polypeptide × 2 Photosystem II reaction center protein T × 2 （P12313） Photosystem II 12 kDa extrinsic protein × 2 Cytochrome c-550 × 2 （P0A387） Photosystem II reaction center protein X × 2 Photosystem II reaction center protein ycf12 × 2 Photosystem II reaction center protein Y × 2 Photosystem II reaction center protein Z × 2 OXYGEN EVOLVING SYSTEM × 2 FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 BROMIDE ION × 4 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_THEVL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–44； UniProt 2–45 Author chain f； PDBConstruct 1–44； UniProt 2–45

Photosystem II reaction center protein J

OrganismNot specified

UniProt Q7DGD4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem Q(B) protein × 2 （P51765） Photosystem II core light harvesting protein × 2 Photosystem II CP43 protein × 2 Photosystem II D2 protein × 2 Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 Photosystem II reaction center protein I × 2 Photosystem II reaction center protein K × 2 Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 Photosystem II manganese-stabilizing polypeptide × 2 Photosystem II reaction center protein T × 2 （P12313） Photosystem II 12 kDa extrinsic protein × 2 Cytochrome c-550 × 2 （P0A387） Photosystem II reaction center protein X × 2 Photosystem II reaction center protein ycf12 × 2 Photosystem II reaction center protein Y × 2 Photosystem II reaction center protein Z × 2 OXYGEN EVOLVING SYSTEM × 2 FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 BROMIDE ION × 4 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_THEVL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40 Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem II reaction center protein L

OrganismNot specified

UniProt P12241

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem Q(B) protein × 2 （P51765） Photosystem II core light harvesting protein × 2 Photosystem II CP43 protein × 2 Photosystem II D2 protein × 2 Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 Photosystem II reaction center protein I × 2 Photosystem II reaction center protein J × 2 （Q7DGD4） Photosystem II reaction center protein K × 2 Photosystem II reaction center protein M × 2 Photosystem II manganese-stabilizing polypeptide × 2 Photosystem II reaction center protein T × 2 （P12313） Photosystem II 12 kDa extrinsic protein × 2 Cytochrome c-550 × 2 （P0A387） Photosystem II reaction center protein X × 2 Photosystem II reaction center protein ycf12 × 2 Photosystem II reaction center protein Y × 2 Photosystem II reaction center protein Z × 2 OXYGEN EVOLVING SYSTEM × 2 FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 BROMIDE ION × 4 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_THEVL
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–37； UniProt 1–37 Author chain l； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein T

OrganismNot specified

UniProt P12313

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem Q(B) protein × 2 （P51765） Photosystem II core light harvesting protein × 2 Photosystem II CP43 protein × 2 Photosystem II D2 protein × 2 Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 Photosystem II reaction center protein I × 2 Photosystem II reaction center protein J × 2 （Q7DGD4） Photosystem II reaction center protein K × 2 Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 Photosystem II manganese-stabilizing polypeptide × 2 Photosystem II 12 kDa extrinsic protein × 2 Cytochrome c-550 × 2 （P0A387） Photosystem II reaction center protein X × 2 Photosystem II reaction center protein ycf12 × 2 Photosystem II reaction center protein Y × 2 Photosystem II reaction center protein Z × 2 OXYGEN EVOLVING SYSTEM × 2 FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 BROMIDE ION × 4 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_THEVL
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain T； PDBConstruct 1–30； UniProt 1–30 Author chain t； PDBConstruct 1–30； UniProt 1–30

Cytochrome c-550

OrganismNot specified

UniProt P0A387

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem Q(B) protein × 2 （P51765） Photosystem II core light harvesting protein × 2 Photosystem II CP43 protein × 2 Photosystem II D2 protein × 2 Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 Photosystem II reaction center protein I × 2 Photosystem II reaction center protein J × 2 （Q7DGD4） Photosystem II reaction center protein K × 2 Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 Photosystem II manganese-stabilizing polypeptide × 2 Photosystem II reaction center protein T × 2 （P12313） Photosystem II 12 kDa extrinsic protein × 2 Photosystem II reaction center protein X × 2 Photosystem II reaction center protein ycf12 × 2 Photosystem II reaction center protein Y × 2 Photosystem II reaction center protein Z × 2 OXYGEN EVOLVING SYSTEM × 2 FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 BROMIDE ION × 4 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY550_THEVL
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain V； PDBConstruct 1–137； UniProt 27–163 Author chain v； PDBConstruct 1–137； UniProt 27–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3a0b
Deposition date deposition_date	2009-03-16
Structure title title	Crystal structure of Br-substituted Photosystem II complex
Keywords keywords	;MULTI-MEMBRANE PROTEIN COMPLEX, Electron transport, Herbicide resistance, Iron, Membrane, Metal-binding, Photosynthesis, Photosystem II, Thylakoid, Transmembrane, Transport, Heme, Reaction center ;; ELECTRON TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3a0b__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3a0b__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3a0b__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.08 Å
Rg (electron density)	56.60 Å
Total Rg	56.86 Å
Atom count	47988
Residues	5242
Excluded volume	887370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3a0b__assembly_1__model_1`	40-meric （40）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (31)

Entity 1 Entity 1 polymer

Description description	Photosystem Q(B) protein
Molecular weight formula_weight	38295.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	47988

MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA

Entity 2 Entity 2 polymer

Description description	Photosystem II core light harvesting protein
Molecular weight formula_weight	54042.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE

Entity 3 Entity 3 polymer

Description description	Photosystem II CP43 protein
Molecular weight formula_weight	48763.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD

Entity 4 Entity 4 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	38118.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9477.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

VGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	4936.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

TSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

Entity 7 Entity 7 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7170.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4052.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	4105.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	3891.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4299.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	4015.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNQLGFIATALFVLVPSVFLIILYVQTESQQKSS

Entity 13 Entity 13 polymer

Description description	Photosystem II manganese-stabilizing polypeptide
Molecular weight formula_weight	26452.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3620.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

METITYVFIFACIIALFFFAIFFREPPRIT

Entity 15 Entity 15 polymer

Description description	Photosystem II 12 kDa extrinsic protein
Molecular weight formula_weight	11095.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,u

EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK

Entity 16 Entity 16 polymer

Description description	Cytochrome c-550
Molecular weight formula_weight	15148.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,v

AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY

Entity 17 Entity 17 polymer

Description description	Photosystem II reaction center protein X
Molecular weight formula_weight	3477.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQID

Entity 18 Entity 18 polymer

Description description	Photosystem II reaction center protein ycf12
Molecular weight formula_weight	2999.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,y

IAQLTMIAMIGIAGPMIIFLLAVRRGNL

Entity 19 Entity 19 polymer

Description description	Photosystem II reaction center protein Y
Molecular weight formula_weight	2060.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,n

XXXXXXXXXXXXXXXXXXXXXXXX

Entity 20 Entity 20 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6766.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV

Entity 21 Entity 21 non-polymer

Description description	OXYGEN EVOLVING SYSTEM
Molecular weight formula_weight	323.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	70

Entity 24 Entity 24 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 25 Entity 25 non-polymer

Description description	5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE
Molecular weight formula_weight	613.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 26 Entity 26 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 27 Entity 27 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	BROMIDE ION
Molecular weight formula_weight	79.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 29 Entity 29 non-polymer

Description description	(1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE
Molecular weight formula_weight	689.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 30 Entity 30 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 31 Entity 31 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 18 domains

CATH v4.4 (18 domains)

Domain ID domain_id	3a0bB02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	680 — Photosystem II CP47 reaction center protein
Homologous superfamily homologous superfamily	10 — Photosystem II CP47 reaction center protein

Domain ID domain_id	3a0bC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	670 — photosystem ii from thermosynechococcus elongatus

Domain ID domain_id	3a0bE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	3a0bH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	880 — Photosystem II reaction center protein H

Domain ID domain_id	3a0bO01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	30 — Photosystem II, cytochrome c-550 precursor

Domain ID domain_id	3a0bO02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2050 — photosynthetic oxygen evolving center fold
Homologous superfamily homologous superfamily	10 — photosynthetic oxygen evolving center domain

Domain ID domain_id	3a0bU01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	320 — Photosystem II 12 kDa extrinsic protein

Domain ID domain_id	3a0bV00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	3a0bZ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	740 — Photosystem II PsbZ, reaction centre

Domain ID domain_id	3a0bb02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	680 — Photosystem II CP47 reaction center protein
Homologous superfamily homologous superfamily	10 — Photosystem II CP47 reaction center protein

Domain ID domain_id	3a0bc02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	670 — photosystem ii from thermosynechococcus elongatus

Domain ID domain_id	3a0be00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	3a0bh01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	880 — Photosystem II reaction center protein H

Domain ID domain_id	3a0bo01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	30 — Photosystem II, cytochrome c-550 precursor

Domain ID domain_id	3a0bo02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2050 — photosynthetic oxygen evolving center fold
Homologous superfamily homologous superfamily	10 — photosynthetic oxygen evolving center domain

Domain ID domain_id	3a0bu01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	320 — Photosystem II 12 kDa extrinsic protein

Domain ID domain_id	3a0bv00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	3a0bz00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	740 — Photosystem II PsbZ, reaction centre

▶

Unit-cell length a length_a	130.589 Å
Unit-cell length b length_b	226.394 Å
Unit-cell length c length_c	307.514 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.700 Å
Low-resolution limit resolution_low	34.700 Å
R factor r_factor	0.3020
R_work r_work	0.3020
R_free r_free	0.3580

Crystal structure of Br-substituted Photosystem II complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem Q(B) protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein T

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c-550

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3a0b__assembly_1__model_1

3a0b__assembly_1__model_1 | I(q)

3a0b__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (31)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer