7czl

Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_THEVL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–324； UniProt 10–333 Author chain a； PDBConstruct 1–324； UniProt 10–333

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt D0VWR1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_THEVL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–505； UniProt 1–505 Author chain b； PDBConstruct 1–505； UniProt 1–505

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt D0VWR7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_THEVL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–446； UniProt 5–450 Author chain c； PDBConstruct 1–446； UniProt 5–450

Photosystem II D2 protein

OrganismNot specified

UniProt D0VWR8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_THEVL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–339； UniProt 3–341 Author chain d； PDBConstruct 1–339； UniProt 3–341

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P12238

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_THEVL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–65； UniProt 20–84 Author chain e； PDBConstruct 1–65； UniProt 20–84

Cytochrome b559 subunit beta

OrganismNot specified

UniProt P12239

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_THEVL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–31； UniProt 14–44 Author chain f； PDBConstruct 1–31； UniProt 14–44

Photosystem II reaction center protein H

OrganismNot specified

UniProt P19052

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_THEVL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–62； UniProt 1–62 Author chain h； PDBConstruct 1–62； UniProt 1–62

Photosystem II reaction center protein I

OrganismNot specified

UniProt P12240

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_THEVL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–34； UniProt 1–34 Author chain i； PDBConstruct 1–34； UniProt 1–34

Photosystem II reaction center protein K

OrganismNot specified

UniProt P19054

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_THEVL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 1–37 Author chain k； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein L

OrganismNot specified

UniProt P12241

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_THEVL
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–37； UniProt 1–37 Author chain l； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein M

OrganismNot specified

UniProt P12312

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_THEVL
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–33； UniProt 1–33 Author chain m； PDBConstruct 1–33； UniProt 1–33

Photosystem II reaction center protein T

OrganismNot specified

UniProt P12313

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_THEVL
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain T； PDBConstruct 1–30； UniProt 1–30 Author chain t； PDBConstruct 1–30； UniProt 1–30

Photosystem II reaction center protein Z

OrganismNot specified

UniProt D0VWR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_THEVL
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

Photosystem II reaction center protein Ycf12

OrganismNot specified

UniProt D0VWR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Psb27 × 2 Photosystem II reaction center protein X × 2 （D0VWR4） CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YCF12_THEVL
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Y； PDBConstruct 1–30； UniProt 1–30 Author chain y； PDBConstruct 1–30； UniProt 1–30

Photosystem II reaction center protein X

OrganismNot specified

UniProt D0VWR4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Photosystem II protein D1 × 2 （P51765） Photosystem II CP47 reaction center protein × 2 （D0VWR1） Photosystem II CP43 reaction center protein × 2 （D0VWR7） Photosystem II D2 protein × 2 （D0VWR8） Cytochrome b559 subunit alpha × 2 （P12238） Cytochrome b559 subunit beta × 2 （P12239） Photosystem II reaction center protein H × 2 （P19052） Photosystem II reaction center protein I × 2 （P12240） Photosystem II reaction center protein K × 2 （P19054） Photosystem II reaction center protein L × 2 （P12241） Photosystem II reaction center protein M × 2 （P12312） Photosystem II reaction center protein T × 2 （P12313） Photosystem II reaction center protein Z × 2 （D0VWR5） Photosystem II reaction center protein Ycf12 × 2 （D0VWR3） Psb27 × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 4 BETA-CAROTENE × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 BICARBONATE ION × 2 (1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 2 FE (II) ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLORIDE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBX_THEVL
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain X； PDBConstruct 1–40； UniProt 1–40 Author chain x； PDBConstruct 1–40； UniProt 1–40

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7czl
Deposition date deposition_date	2020-09-09
Structure title title	Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus
Keywords keywords	dimeric photosystem II (PSII)-Psb27 complex from a cyanobacterium Thermosynechococcus vulcanus, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7czl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7czl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7czl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.54 Å
Rg (electron density)	55.75 Å
Total Rg	55.97 Å
Atom count	40859
Residues	4304
Excluded volume	759090 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7czl__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	35894.9 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	40859

SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHE

Entity 2 Entity 2 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56096.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRR

Entity 3 Entity 3 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	48648.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSL

Entity 4 Entity 4 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	38005.5 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNA

Entity 5 Entity 5 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	7495.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

WVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	3461.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

PIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQ

Entity 7 Entity 7 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	6986.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWK

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	3923.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

METLKITVYIVVTFFVLLFVFGFLSGDPARNPKR

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	4101.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4299.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3678.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNQLGLIATALFVLVPSVFLIILYVQTESQQ

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3620.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

METITYVFIFACIIALFFFAIFFREPPRIT

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6766.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein Ycf12
Molecular weight formula_weight	3228.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,y

EVIAQLTMIAMIGIAGPMIIFLLAVRRGNL

Entity 15 Entity 15 polymer

Description description	Psb27
Molecular weight formula_weight	12234.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n,N

TGLTGNFREDTLALISSLREAIALPENDPNKKAAQAEARKKLNDFFALYRRDDSLRSLSSFMTMQTALNSLAGHYSSYPNRPLPEKLKARLEQEFKQVELALDREAKS

Entity 16 Entity 16 polymer

Description description	Photosystem II reaction center protein X
Molecular weight formula_weight	4191.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL

Entity 17 Entity 17 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	70

Entity 18 Entity 18 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 19 Entity 19 non-polymer

Description description	5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE
Molecular weight formula_weight	613.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 20 Entity 20 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 21 Entity 21 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 23 Entity 23 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 24 Entity 24 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	(1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE
Molecular weight formula_weight	689.0 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 26 Entity 26 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 27 Entity 27 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	7czlA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	7czlE01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	7czla01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	7czle01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.78 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	87473

Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer