6w1v

RT XFEL structure of the two-flash state of Photosystem II (2F, S3-rich) at 2.09 Angstrom resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA1_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–344； UniProt 1–344 Author chain a； PDBConstruct 1–344； UniProt 1–344

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt Q8DIQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–510； UniProt 1–510 Author chain b； PDBConstruct 1–510； UniProt 1–510

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt Q8DIF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_THEEB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–461； UniProt 1–461 Author chain c； PDBConstruct 1–461； UniProt 1–461

Photosystem II D2 protein

OrganismNot specified

UniProt Q8CM25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_THEEB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 1–352 Author chain d； PDBConstruct 1–352； UniProt 1–352

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt Q8DIP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_THEEB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–84； UniProt 1–84 Author chain e； PDBConstruct 1–84； UniProt 1–84

Cytochrome b559 subunit beta

OrganismNot specified

UniProt Q8DIN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_THEEB
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–45； UniProt 1–45 Author chain f； PDBConstruct 1–45； UniProt 1–45

Photosystem II reaction center protein H

OrganismNot specified

UniProt Q8DJ43

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_THEEB
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–66； UniProt 1–66 Author chain h； PDBConstruct 1–66； UniProt 1–66

Photosystem II reaction center protein I

OrganismNot specified

UniProt Q8DJZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_THEEB
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 2–38； UniProt 2–38 Author chain i； PDBConstruct 2–38； UniProt 2–38

Photosystem II reaction center protein J

OrganismNot specified

UniProt P59087

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_THEEB
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40 Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem II reaction center protein K

OrganismNot specified

UniProt Q9F1K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_THEEB
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–46； UniProt 1–46 Author chain k； PDBConstruct 1–46； UniProt 1–46

Photosystem II reaction center protein L

OrganismNot specified

UniProt Q8DIN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_THEEB
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–37； UniProt 1–37 Author chain l； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein M

OrganismNot specified

UniProt Q8DHA7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_THEEB
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 2–36； UniProt 2–36 Author chain m； PDBConstruct 2–36； UniProt 2–36

Photosystem II manganese-stabilizing polypeptide

OrganismNot specified

UniProt P0A431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO_THEEB
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–272； UniProt 1–272 Author chain o； PDBConstruct 1–272； UniProt 1–272

Photosystem II protein Y

OrganismNot specified

UniProt Q8DKM3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBY_THEEB
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain R； PDBConstruct 1–41； UniProt 1–41 Author chain r； PDBConstruct 1–41； UniProt 1–41

Photosystem II reaction center protein T

OrganismNot specified

UniProt Q8DIQ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_THEEB
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain T； PDBConstruct 2–32； UniProt 2–32 Author chain t； PDBConstruct 2–32； UniProt 2–32

Photosystem II 12 kDa extrinsic protein

OrganismNot specified

UniProt Q9F1L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBU_THEEB
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain U； PDBConstruct 1–134； UniProt 1–134 Author chain u； PDBConstruct 1–134； UniProt 1–134

Cytochrome c-550

OrganismNot specified

UniProt P0A386

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY550_THEEB
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain V； PDBConstruct 1–163； UniProt 1–163 Author chain v； PDBConstruct 1–163； UniProt 1–163

Photosystem II reaction center X protein

OrganismNot specified

UniProt Q9F1R6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBX_THEEB
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain X； PDBConstruct 1–41； UniProt 1–41 Author chain x； PDBConstruct 1–41； UniProt 1–41

Photosystem II reaction center protein Ycf12

OrganismNot specified

UniProt Q8DJI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Z × 2 （Q8DHJ2） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YCF12_THEEB
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Y； PDBConstruct 1–46； UniProt 1–46 Author chain y； PDBConstruct 1–46； UniProt 1–46

Photosystem II reaction center protein Z

OrganismNot specified

UniProt Q8DHJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem II protein D1 1 × 2 （P0A444） Photosystem II CP47 reaction center protein × 2 （Q8DIQ1） Photosystem II CP43 reaction center protein × 2 （Q8DIF8） Photosystem II D2 protein × 2 （Q8CM25） Cytochrome b559 subunit alpha × 2 （Q8DIP0） Cytochrome b559 subunit beta × 2 （Q8DIN9） Photosystem II reaction center protein H × 2 （Q8DJ43） Photosystem II reaction center protein I × 2 （Q8DJZ6） Photosystem II reaction center protein J × 2 （P59087） Photosystem II reaction center protein K × 2 （Q9F1K9） Photosystem II reaction center protein L × 2 （Q8DIN8） Photosystem II reaction center protein M × 2 （Q8DHA7） Photosystem II manganese-stabilizing polypeptide × 2 （P0A431） Photosystem II protein Y × 2 （Q8DKM3） Photosystem II reaction center protein T × 2 （Q8DIQ0） Photosystem II 12 kDa extrinsic protein × 2 （Q9F1L5） Cytochrome c-550 × 2 （P0A386） Photosystem II reaction center X protein × 2 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 2 （Q8DJI1） FE (II) ION × 2 CHLOROPHYLL A × 70 BETA-CAROTENE × 22 CHLORIDE ION × 4 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 STEARIC ACID × 38 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 9 CA-MN4-O5 CLUSTER × 2 CA-MN4-O6 CLUSTER × 2 BICARBONATE ION × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 13 PHEOPHYTIN A × 4 HEME C × 4 water × 39	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_THEEB
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6w1v
Deposition date deposition_date	2020-03-04
Structure title title	RT XFEL structure of the two-flash state of Photosystem II (2F, S3-rich) at 2.09 Angstrom resolution
Keywords keywords	water oxidation, membrane protein, light harvesting, electron transfer, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6w1v__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6w1v__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6w1v__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.76 Å
Rg (electron density)	57.10 Å
Total Rg	57.34 Å
Atom count	101753
Residues	5302
Excluded volume	935070 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6w1v__assembly_1__model_1`	40-meric （40）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (36)

Entity 1 Entity 1 polymer

Description description	Photosystem II protein D1 1
Molecular weight formula_weight	38265.6 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	106211

MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA

Entity 2 Entity 2 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56656.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRRKEAV

Entity 3 Entity 3 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	50287.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

MVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD

Entity 4 Entity 4 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39388.2 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9580.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	5067.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

Entity 7 Entity 7 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7358.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4438.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	4105.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	5028.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

MIDALVLVAKLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4299.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	4009.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS

Entity 13 Entity 13 polymer

Description description	Photosystem II manganese-stabilizing polypeptide
Molecular weight formula_weight	29637.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

MKYRILMATLLAVCLGIFSLSAPAFAAKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA

Entity 14 Entity 14 polymer

Description description	Photosystem II protein Y
Molecular weight formula_weight	4590.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,r

MDWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLLQKAKAA

Entity 15 Entity 15 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3906.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

METITYVFIFACIIALFFFAIFFREPPRITKK

Entity 16 Entity 16 polymer

Description description	Photosystem II 12 kDa extrinsic protein
Molecular weight formula_weight	15031.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,u

MQRLGRWLALAYFVGVSLLGWINWSAPTLAATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK

Entity 17 Entity 17 polymer

Description description	Cytochrome c-550
Molecular weight formula_weight	18046.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,v

MLKKCVWLAVALCLCLWQFTMGTALAAELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY

Entity 18 Entity 18 polymer

Description description	Photosystem II reaction center X protein
Molecular weight formula_weight	4322.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

MTITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL

Entity 19 Entity 19 polymer

Description description	Photosystem II reaction center protein Ycf12
Molecular weight formula_weight	5039.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,y

MGIFNGIIEFLSNINFEVIAQLTMIAMIGIAGPMIIFLLAVRRGNL

Entity 20 Entity 20 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6766.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV

Entity 21 Entity 21 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	70

Entity 23 Entity 23 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 24 Entity 24 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 25 Entity 25 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 26 Entity 26 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 27 Entity 27 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 28 Entity 28 non-polymer

Description description	STEARIC ACID
Molecular weight formula_weight	284.5 kDa
Source method src_method	syn
Copy count entity_count	38

Entity 29 Entity 29 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 30 Entity 30 non-polymer

Description description	CA-MN4-O5 CLUSTER
Molecular weight formula_weight	339.8 kDa
Source method src_method	man
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	CA-MN4-O6 CLUSTER
Molecular weight formula_weight	355.8 kDa
Source method src_method	man
Copy count entity_count	2

Entity 32 Entity 32 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 33 Entity 33 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 34 Entity 34 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 35 Entity 35 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 36 Entity 36 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2002

▶

Unit-cell length a length_a	116.958 Å
Unit-cell length b length_b	221.646 Å
Unit-cell length c length_c	307.786 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	2.090 Å
Low-resolution limit resolution_low	33.650 Å
R factor r_factor	0.1830
R_work r_work	0.1820
R_free r_free	0.2410

RT XFEL structure of the two-flash state of Photosystem II (2F, S3-rich) at 2.09 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer