7nhp

Structure of PSII-I (PSII with Psb27, Psb28, and Psb34)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA1_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–360； UniProt 1–360

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt Q8DIQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–510； UniProt 1–510

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt Q8DIF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_THEEB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–461； UniProt 1–461

Photosystem II D2 protein

OrganismNot specified

UniProt Q8CM25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_THEEB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 1–352

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt Q8DIP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_THEEB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–84； UniProt 1–84

Cytochrome b559 subunit beta

OrganismNot specified

UniProt Q8DIN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_THEEB
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–45； UniProt 1–45

Photosystem II reaction center protein H

OrganismNot specified

UniProt Q8DJ43

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_THEEB
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–66； UniProt 1–66

Photosystem II reaction center protein I

OrganismNot specified

UniProt Q8DJZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_THEEB
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein K

OrganismNot specified

UniProt Q9F1K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_THEEB
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–46； UniProt 1–46

Photosystem II reaction center protein L

OrganismNot specified

UniProt Q8DIN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_THEEB
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein M

OrganismNot specified

UniProt Q8DHA7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_THEEB
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–36； UniProt 1–36

Photosystem II reaction center protein T

OrganismNot specified

UniProt Q8DIQ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_THEEB
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain T； PDBConstruct 1–32； UniProt 1–32

Photosystem II reaction center X protein

OrganismNot specified

UniProt Q9F1R6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBX_THEEB
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain X； PDBConstruct 1–41； UniProt 1–41

Photosystem II reaction center protein Ycf12

OrganismNot specified

UniProt Q8DJI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YCF12_THEEB
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain y； PDBConstruct 1–46； UniProt 1–46

Photosystem II reaction center protein Z

OrganismNot specified

UniProt Q8DHJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_THEEB
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62

Photosystem II lipoprotein Psb27

OrganismNot specified

UniProt Q8DG60

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB27_THEEB
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 1； PDBConstruct 1–134； UniProt 1–134

Photosystem II reaction center Psb28 protein

OrganismNot specified

UniProt Q8DLJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Tsl0063 protein × 1 （Q8DMP8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB28_THEEB
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 2； PDBConstruct 1–116； UniProt 1–116

Tsl0063 protein

OrganismNot specified

UniProt Q8DMP8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem II protein D1 1 × 1 （P0A444） Photosystem II CP47 reaction center protein × 1 （Q8DIQ1） Photosystem II CP43 reaction center protein × 1 （Q8DIF8） Photosystem II D2 protein × 1 （Q8CM25） Cytochrome b559 subunit alpha × 1 （Q8DIP0） Cytochrome b559 subunit beta × 1 （Q8DIN9） Photosystem II reaction center protein H × 1 （Q8DJ43） Photosystem II reaction center protein I × 1 （Q8DJZ6） Photosystem II reaction center protein K × 1 （Q9F1K9） Photosystem II reaction center protein L × 1 （Q8DIN8） Photosystem II reaction center protein M × 1 （Q8DHA7） Photosystem II reaction center protein T × 1 （Q8DIQ0） Photosystem II reaction center X protein × 1 （Q9F1R6） Photosystem II reaction center protein Ycf12 × 1 （Q8DJI1） Photosystem II reaction center protein Z × 1 （Q8DHJ2） Photosystem II lipoprotein Psb27 × 1 （Q8DG60） Photosystem II reaction center Psb28 protein × 1 （Q8DLJ8） MANGANESE (II) ION × 1 CHLORIDE ION × 1 PHEOPHYTIN A × 2 CHLOROPHYLL A × 35 BETA-CAROTENE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 FE (III) ION × 1 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 1 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DMP8_THEEB
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 3； PDBConstruct 1–56； UniProt 1–56

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nhp
Deposition date deposition_date	2021-02-11
Structure title title	Structure of PSII-I (PSII with Psb27, Psb28, and Psb34)
Keywords keywords	Membrane Protein Biogenesis Assembly Factors Photosystem II, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7nhp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7nhp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7nhp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.40 Å
Rg (electron density)	43.31 Å
Total Rg	43.85 Å
Atom count	21839
Residues	2350
Excluded volume	404630 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7nhp__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Description description	Photosystem II protein D1 1
Molecular weight formula_weight	39762.3 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	21839

MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLASAESAPVAMIAPSING

Entity 2 Entity 2 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56656.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRRKEAV

Entity 3 Entity 3 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	50287.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD

Entity 4 Entity 4 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39388.2 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9580.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	5067.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

Entity 7 Entity 7 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7358.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4410.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	5028.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MIDALVLVAKLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4299.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3981.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3878.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

METITYVFIFACIIALFFFAIFFREPPRITKK

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center X protein
Molecular weight formula_weight	4322.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MTITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein Ycf12
Molecular weight formula_weight	5039.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MGIFNGIIEFLSNINFEVIAQLTMIAMIGIAGPMIIFLLAVRRGNL

Entity 15 Entity 15 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6766.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV

Entity 16 Entity 16 polymer

Description description	Photosystem II lipoprotein Psb27
Molecular weight formula_weight	15120.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MKRFWAMVCALFLSVSLLLTSCANVPTGLTGNFREDTLALISSLREAIALPENDPNKKAAQAEARKKLNDFFALYRRDDSLRSLSSFMTMQTALNSLAGHYSSYPNRPLPEKLKARLEQEFKQVELALDREAKS

Entity 17 Entity 17 polymer

Description description	Photosystem II reaction center Psb28 protein
Molecular weight formula_weight	13188.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MGAMAEIQFIRGINEEVVPDVRLTRARDGSSGQAMFYFDNPKIVQEGNLEVTGMYMVDEEGEIVTRDVNAKFINGQPVAIEATYTMRSPQEWDRFIRFMDRYAASHGLGFQKSENS

Entity 18 Entity 18 polymer

Description description	Tsl0063 protein
Molecular weight formula_weight	5943.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MRYTTDEGGRLNNFAIEPKVYQAQPWTPQQKVRAALLVGGGLLLVAGLVAIAVGVS

Entity 19 Entity 19 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	35

Entity 23 Entity 23 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 24 Entity 24 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 26 Entity 26 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 28 Entity 28 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (14 domains)

Domain ID domain_id	d7nhpa_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d7nhpb_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.55 — Photosystem II antenna protein-like
Superfamily Superfamily superfamily	f.55.1 — Photosystem II antenna protein-like
Family Family family	f.55.1.1 — Photosystem II antenna protein-like

Domain ID domain_id	d7nhpc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.55 — Photosystem II antenna protein-like
Superfamily Superfamily superfamily	f.55.1 — Photosystem II antenna protein-like
Family Family family	f.55.1.1 — Photosystem II antenna protein-like

Domain ID domain_id	d7nhpd_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d7nhpe_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.38 — Cytochrome b559 subunits
Family Family family	f.23.38.1 — Cytochrome b559 subunits

Domain ID domain_id	d7nhpf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.38 — Cytochrome b559 subunits
Family Family family	f.23.38.1 — Cytochrome b559 subunits

Domain ID domain_id	d7nhph_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.33 — Photosystem II 10 kDa phosphoprotein PsbH
Family Family family	f.23.33.1 — PsbH-like

Domain ID domain_id	d7nhpi_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.37 — Photosystem II reaction center protein I, PsbI
Family Family family	f.23.37.1 — PsbI-like

Domain ID domain_id	d7nhpk_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.36 — Photosystem II reaction center protein K, PsbK
Family Family family	f.23.36.1 — PsbK-like

Domain ID domain_id	d7nhpl_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.31 — Photosystem II reaction center protein L, PsbL
Family Family family	f.23.31.1 — PsbL-like

Domain ID domain_id	d7nhpm_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.35 — Photosystem II reaction center protein M, PsbM
Family Family family	f.23.35.1 — PsbM-like

Domain ID domain_id	d7nhpt_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.34 — Photosystem II reaction center protein T, PsbT
Family Family family	f.23.34.1 — PsbT-like

Domain ID domain_id	d7nhpx_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.40 — Photosystem II reaction center protein X, PsbX
Family Family family	f.23.40.1 — PsbX-like

Domain ID domain_id	d7nhpz_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.5 — PsbZ-like
Family Family family	f.17.5.1 — PsbZ-like

CATH v4.4 (2 domains)

Domain ID domain_id	7nhpA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	7nhpE01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.72 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	57268

Structure of PSII-I (PSII with Psb27, Psb28, and Psb34)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer