SAXSdb — 3mlq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit beta

Thermus aquaticus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Transcription-repair coupling factor × 1 （Q72KB4） PHOSPHATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Transcription-repair coupling factor × 1 （Q72KB4）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Transcription-repair coupling factor × 1 （Q72KB4）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Transcription-repair coupling factor × 1 （Q72KB4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOB_THEAQ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–124； UniProt 17–139 Author chain A； PDBConstruct 127–188； UniProt 334–395 Author chain B； PDBConstruct 2–124； UniProt 17–139 Author chain B； PDBConstruct 127–188； UniProt 334–395 Author chain C； PDBConstruct 2–124； UniProt 17–139 Author chain C； PDBConstruct 127–188； UniProt 334–395 Author chain D； PDBConstruct 2–124； UniProt 17–139 Author chain D； PDBConstruct 127–188； UniProt 334–395

Transcription-repair coupling factor

Thermus thermophilus

UniProt Q72KB4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	DNA-directed RNA polymerase subunit beta × 1 （Q9KWU7） PHOSPHATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	DNA-directed RNA polymerase subunit beta × 1 （Q9KWU7）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	DNA-directed RNA polymerase subunit beta × 1 （Q9KWU7）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	DNA-directed RNA polymerase subunit beta × 1 （Q9KWU7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72KB4_THET2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 5–71； UniProt 321–387 Author chain F； PDBConstruct 5–71； UniProt 321–387 Author chain G； PDBConstruct 5–71； UniProt 321–387 Author chain H； PDBConstruct 5–71； UniProt 321–387

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3mlq
Deposition date deposition_date	2010-04-18
Structure title title	Crystal structure of the Thermus thermophilus transcription-repair coupling factor RNA polymerase interacting domain with the Thermus aquaticus RNA polymerase beta1 domain
Keywords keywords	Tudor, TRANSFERASE-TRANSCRIPTION complex; TRANSFERASE/TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3mlq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3mlq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3mlq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.69 Å
Rg (electron density)	19.95 Å
Total Rg	20.82 Å
Atom count	1745
Residues	224
Excluded volume	31169 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3mlq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3mlq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3mlq__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3mlq__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	21081.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	6863

MPLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGGLVLDFLEYRIGDPPFSQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHLPLMTEDGSFIINGADRVIVSQGGRTVGELMADQFRVGLARLARGVRERMVMGSPDTLTPAKLVNSRPLEAALREFFSRSQLSQFK

Source Source

Source organism organism	Thermus aquaticus
NCBI taxonomy ID ncbi_taxonomy_id	271
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Transcription-repair coupling factor
Molecular weight formula_weight	8002.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

GPHMPGDYLIHPEHGVGQYLGLETREVLGVKRDYLVLRYKGEGKLYLPVEQLPLLKRHPGTTDDPPELSSL

Source Source

Source organism organism	Thermus thermophilus
NCBI taxonomy ID ncbi_taxonomy_id	262724
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3mlqG00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3mlqH00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

▶

Unit-cell length a length_a	106.585 Å
Unit-cell length b length_b	106.585 Å
Unit-cell length c length_c	122.301 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43
Space-group number int_tables_number	78
Crystal system crystal_system	—

Resolution resolution	2.910 Å
Low-resolution limit resolution_low	29.560 Å
R factor r_factor	0.2279
R_work r_work	0.2269
R_free r_free	0.2498

Crystal structure of the Thermus thermophilus transcription-repair coupling factor RNA polymerase interacting domain with the Thermus aquaticus RNA polymerase beta1 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Transcription-repair coupling factor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3mlq__assembly_1__model_1

3mlq__assembly_1__model_1 | I(q)

3mlq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of the Thermus thermophilus transcription-repair coupling factor RNA polymerase interacting domain with the Thermus aquaticus RNA polymerase beta1 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription-repair coupling factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3mlq__assembly_1__model_1

3mlq__assembly_1__model_1 | I(q)

3mlq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)