SAXSdb — 3rdv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CAP-Gly domain-containing linker protein 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 56–127	Fragment：CAP-Gly 1 domain, residues 56-127	SLAIN motif-containing protein 2 × 1 （Q9P270） NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 56–127	Fragment：CAP-Gly 1 domain, residues 56-127	SLAIN motif-containing protein 2 × 1 （Q9P270）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 56–127	Fragment：CAP-Gly 1 domain, residues 56-127	SLAIN motif-containing protein 2 × 1 （Q9P270） BME BETA-MERCAPTOETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 56–127	Fragment：CAP-Gly 1 domain, residues 56-127	SLAIN motif-containing protein 2 × 1 （Q9P270）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3RDV	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2CP5 Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin Deposited 2005-05-19	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–128（128 aa） Fragment：CAP-Gly domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120；Pressure ambient NMR sample composition 1mM protein, 20mM d-Tris-HCl, pH7.0, 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2CP6 Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin Deposited 2005-05-19	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 181–339（159 aa） Fragment：CAP-Gly domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120；Pressure ambient NMR sample composition 1mM protein, 20mM d-Tris-HCl, pH7.0, 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2E3H Crystal structure of the CLIP-170 CAP-Gly domain 2 Deposited 2006-11-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 211–300（90 aa） Fragment：CAP-Gly domain 2	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.45 Å R-free 0.215
2E3I Crystal structure of the CLIP-170 CAP-Gly domain 1 Deposited 2006-11-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 56–141（86 aa） Fragment：CAP-Gly domain 1	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；VAPOR DIFFUSION, HANGING DROP	Resolution 2.00 Å R-free 0.259
2E4H Solution structure of cytoskeletal protein in complex with tubulin tail Deposited 2006-12-08	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 203–300（98 aa） Fragment：CAP-Gly domain 2, residues 203-300	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.9；303 K；Pressure ambient NMR sample composition 0.9mM U-15N,13C CLIP: Nonlabel tubulin; 30mM BisTris buffer K; 1mM DTT; 100% D2O \| 100% D2O NMR sample composition 0.9mM U-15N CLIP: Nonlabel tubulin; 30mM BisTris buffer K; 1mM DTT; 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.9mM U-15N,13C tubulin: Nonlabel CLIP; 30mM BisTris buffer K; 1mM DTT; 100% D2O \| 100% D2O NMR sample composition 0.9mM U-15N tubulin: Nonlabel CLIP; 30mM BisTris buffer K; 1mM DTT; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain E 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427 Chain F 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427 Chain G 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427 Chain H 1405–1427（23 aa） Fragment：second zinc finger domain, residues 1405-1427	Not recorded	ZN ZINC ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2QK0 Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1 Deposited 2007-07-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 57–128（72 aa） Fragment：Cap-Gly domain 1	Mutation：L124M Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；1.2 M Sodium malonate, 100 mM Glycine, 1.1 mM Lanthanum chloride, Protein concentration 15 mg/ml, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.233
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1388–1427（40 aa） Fragment：Zn-knuckle 2	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1388–1427（40 aa） Fragment：Zn-knuckle 2	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1388–1427（40 aa） Fragment：Zn-knuckle 2	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1388–1427（40 aa） Fragment：Zn-knuckle 2	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1388–1427（40 aa） Fragment：Zn-knuckle 2 Chain F 1388–1427（40 aa） Fragment：Zn-knuckle 2 Chain G 1388–1427（40 aa） Fragment：Zn-knuckle 2 Chain H 1388–1427（40 aa） Fragment：Zn-knuckle 2	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238

8 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CLIP1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–72； UniProt 56–127 Author chain B； PDBConstruct 1–72； UniProt 56–127 Author chain C； PDBConstruct 1–72； UniProt 56–127 Author chain D； PDBConstruct 1–72； UniProt 56–127

SLAIN motif-containing protein 2

OrganismNot specified

UniProt Q9P270

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 574–581	Fragment：C-terminal domain, residues 574-581	CAP-Gly domain-containing linker protein 1 × 1 （P30622） NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 574–581	Fragment：C-terminal domain, residues 574-581	CAP-Gly domain-containing linker protein 1 × 1 （P30622）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 574–581	Fragment：C-terminal domain, residues 574-581	CAP-Gly domain-containing linker protein 1 × 1 （P30622） BME BETA-MERCAPTOETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain H； UniProt 574–581	Fragment：C-terminal domain, residues 574-581	CAP-Gly domain-containing linker protein 1 × 1 （P30622）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 4.5；298 K；36% PEG 6000, 100mM citric acid, pH 4.5, vapor diffusion, temperature 298K	Resolution 1.75 Å R-free 0.229

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	SLAI2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–8； UniProt 574–581 Author chain F； PDBConstruct 1–8； UniProt 574–581 Author chain G； PDBConstruct 1–8； UniProt 574–581 Author chain H； PDBConstruct 1–8； UniProt 574–581

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3rdv
Deposition date deposition_date	2011-04-01
Structure title title	Structure of the SLAIN2c-CLIPCG1 complex
Keywords keywords	Cytoskeletal protein, CAP GLY protein complex, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.22 Å
Radius of gyration Rg (electron density) rg_electron	22.28 Å
Forward intensity I(0) i0	20430200.00
Molecular weight molecular_weight	34885.0 kDa
Excluded volume excluded_volume	43876 Å³
Envelope volume envelope_volume	52643 Å³
Hydration-shell volume shell_volume	20456 Å³
Envelope diameter envelope_diameter	69.6 Å
Shell Rg shell_rg	28.10 Å
Envelope Rg envelope_rg	22.13 Å
Shape Rg shape_rg	22.27 Å
Total Rg total_rg	23.12 Å
Total atoms total_atoms	2476
Residues n_residues	315
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	67.3 Å
Rg (real space) rg_real	23.09 Å
Rg uncertainty (real space) rg_real_error	0.34 Å
I(0) (real space) i0_real	2.0430e+07
I(0) uncertainty (real space) i0_real_error	2.4760e+05
Rg (reciprocal space) rg_reciprocal	23.12 Å
I(0) (reciprocal space) i0_reciprocal	20430000.0000
Solution quality estimate total_estimate	0.9178
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.2 Å
Skewness Skewness skewness	0.031
Kurtosis Kurtosis kurtosis	-0.730
Angular range angular_range	— – 0.3400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6529000.0000
Real-space data points n_real_points	66
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.982; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.983

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	CAP-Gly domain-containing linker protein 1
Molecular weight formula_weight	8050.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2772

DDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	SLAIN motif-containing protein 2
Molecular weight formula_weight	974.0 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

DSWKDGCY

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	BETA-MERCAPTOETHANOL
Molecular weight formula_weight	78.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	288

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3rdvA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	190 — CAP Gly-rich-like domain

Domain ID domain_id	3rdvB00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	190 — CAP Gly-rich-like domain

Domain ID domain_id	3rdvC00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	190 — CAP Gly-rich-like domain

Domain ID domain_id	3rdvD00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	190 — CAP Gly-rich-like domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	38.210 Å
Unit-cell length b length_b	45.740 Å
Unit-cell length c length_c	49.360 Å
Unit-cell angle α angle_alpha	100.06 °
Unit-cell angle β angle_beta	105.76 °
Unit-cell angle γ angle_gamma	108.39 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	45.536 Å
R factor r_factor	0.1836
R_work r_work	0.1801
R_free r_free	0.2288

fit	/app/data/saxs_computation/rd/3rdv/3rdv.fit
pddf	/app/data/pr_computation/rd/3rdv/3rdv.pr.out
profile	/app/data/saxs_computation/rd/3rdv/3rdv.dat

Structure of the SLAIN2c-CLIPCG1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

CAP-Gly domain-containing linker protein 1

State in the Current Structure

Other States of the Same Protein in the Database

SLAIN motif-containing protein 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)