SAXSdb — 3s3z

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tandem Cyanovirin-N Dimer CVN2L10

Nostoc ellipsosporum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SODIUM ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CVN_NOSEL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 12–112； UniProt 1–101 Author chain A； PDBConstruct 123–223； UniProt 1–101

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3s3z
Deposition date deposition_date	2011-05-18
Structure title title	Crystal Structure an Tandem Cyanovirin-N Dimer, CVN2L10
Keywords keywords	cyanovirin-N, sugar-binding, gp120, engineered dimer, ANTIVIRAL PROTEIN; ANTIVIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3s3z__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3s3z__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3s3z__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.41 Å
Rg (electron density)	19.53 Å
Total Rg	20.19 Å
Atom count	788
Residues	105
Excluded volume	13795 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3s3z__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tandem Cyanovirin-N Dimer CVN2L10
Molecular weight formula_weight	23999.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	908

GHHHHHHIEGRLGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYEGGSGGGGSGGLGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE

Source Source

Source organism organism	Nostoc ellipsosporum
NCBI taxonomy ID ncbi_taxonomy_id	45916
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	87

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3s3za1
Class class	b — All beta proteins
Fold Fold fold	b.89 — Cyanovirin-N
Superfamily Superfamily superfamily	b.89.1 — Cyanovirin-N
Family Family family	b.89.1.1 — Cyanovirin-N

Domain ID domain_id	d3s3za2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	3s3zA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	60 — HIV-inactivating Protein, Cyanovirin-n
Homologous superfamily homologous superfamily	10 — Cyanovirin-N

▶

Unit-cell length a length_a	47.990 Å
Unit-cell length b length_b	47.990 Å
Unit-cell length c length_c	79.318 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	36.810 Å
R factor r_factor	0.1895
R_work r_work	0.1884
R_free r_free	0.2118

Crystal Structure an Tandem Cyanovirin-N Dimer, CVN2L10

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tandem Cyanovirin-N Dimer CVN2L10

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3s3z__assembly_1__model_1

3s3z__assembly_1__model_1 | I(q)

3s3z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal Structure an Tandem Cyanovirin-N Dimer, CVN2L10

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tandem Cyanovirin-N Dimer CVN2L10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3s3z__assembly_1__model_1

3s3z__assembly_1__model_1 | I(q)

3s3z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

7. Citations (1)