SAXSdb — 6x7h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyanovirin-N

Nostoc ellipsosporum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Homooligomer	Protein 2 其他Polymer 2	alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CVN_NOSEL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–101； UniProt 1–101 Author chain B； PDBConstruct 1–101； UniProt 1–101

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6x7h
Deposition date deposition_date	2020-05-30
Structure title title	Cyanovirin-N Mutation I34Y with Dimannose bound
Keywords keywords	Mannose binding protein Antiviral protein, ANTIVIRAL PROTEIN; ANTIVIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6x7h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6x7h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6x7h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.48 Å
Rg (electron density)	17.39 Å
Total Rg	18.24 Å
Atom count	3027
Residues	200
Excluded volume	27110 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6x7h__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Cyanovirin-N
Molecular weight formula_weight	11999.1 kDa
Mutation mutation	I34Y
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3403

LGNFSQACYNSAIQGSVLTSTCIRTNGGYNTSSYDLNSVIENVDGSLKWQGSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIAAIDGTLKYELEHHHHHH

Source Source

Source organism organism	Nostoc ellipsosporum
NCBI taxonomy ID ncbi_taxonomy_id	45916
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 branched

Description description	alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose
Molecular weight formula_weight	342.3 kDa
Source method src_method	man
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	296

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d6x7ha_
Class class	b — All beta proteins
Fold Fold fold	b.89 — Cyanovirin-N
Superfamily Superfamily superfamily	b.89.1 — Cyanovirin-N
Family Family family	b.89.1.1 — Cyanovirin-N

Domain ID domain_id	d6x7hb_
Class class	b — All beta proteins
Fold Fold fold	b.89 — Cyanovirin-N
Superfamily Superfamily superfamily	b.89.1 — Cyanovirin-N
Family Family family	b.89.1.1 — Cyanovirin-N

▶

Unit-cell length a length_a	49.724 Å
Unit-cell length b length_b	38.011 Å
Unit-cell length c length_c	55.867 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	1.250 Å
Low-resolution limit resolution_low	15.430 Å
R factor r_factor	0.1413
R_work r_work	0.1403
R_free r_free	0.1734

Cyanovirin-N Mutation I34Y with Dimannose bound

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyanovirin-N

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6x7h__assembly_1__model_1

6x7h__assembly_1__model_1 | I(q)

6x7h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (3)

Cyanovirin-N Mutation I34Y with Dimannose bound

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyanovirin-N

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6x7h__assembly_1__model_1

6x7h__assembly_1__model_1 | I(q)

6x7h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (3)