SAXSdb — 3uez

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted protein BARF1

Human herpesvirus 4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 6 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 21–221 Chain D； UniProt 21–221	Mutation：T169S	Macrophage colony-stimulating factor 1 × 6 （P09603） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.1M Tris HCl, 1.0M ammonium sulphate, pH 8.50, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.41 Å R-free 0.274
2	Other combination Heteromer Protein × 12 其他Polymer 6 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain B； UniProt 21–221 Chain C； UniProt 21–221	Mutation：T169S	Macrophage colony-stimulating factor 1 × 6 （P09603） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.1M Tris HCl, 1.0M ammonium sulphate, pH 8.50, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.41 Å R-free 0.274

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3UEZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2CH8 Structure of the Epstein-Barr Virus Oncogene BARF1 Deposited 2006-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 21–221（201 aa） Chain D 21–221（201 aa）	Not recorded	PT PLATINUM (II) ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；1 M AMMONIUM SULPHATE,1-2 % PEG 3350,100 MM BISTRIS/HCL PH 6.0	Resolution 2.30 Å R-free 0.233
2CH8 Structure of the Epstein-Barr Virus Oncogene BARF1 Deposited 2006-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 21–221（201 aa） Chain C 21–221（201 aa）	Not recorded	PT PLATINUM (II) ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；1 M AMMONIUM SULPHATE,1-2 % PEG 3350,100 MM BISTRIS/HCL PH 6.0	Resolution 2.30 Å R-free 0.233

1 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BARF1_EBVB9
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–201； UniProt 21–221 Author chain B； PDBConstruct 1–201； UniProt 21–221 Author chain C； PDBConstruct 1–201； UniProt 21–221 Author chain D； PDBConstruct 1–201； UniProt 21–221

Macrophage colony-stimulating factor 1

Homo sapiens

UniProt P09603

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 6 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain E； UniProt 33–181 Chain F； UniProt 33–181	Fragment：UNP RESIDUES 33-181	Secreted protein BARF1 × 6 （P03228） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.1M Tris HCl, 1.0M ammonium sulphate, pH 8.50, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.41 Å R-free 0.274
2	Other combination Heteromer Protein × 12 其他Polymer 6 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain G； UniProt 33–181 Chain H； UniProt 33–181	Fragment：UNP RESIDUES 33-181	Secreted protein BARF1 × 6 （P03228） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.1M Tris HCl, 1.0M ammonium sulphate, pH 8.50, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.41 Å R-free 0.274

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3UEZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1HMC THREE-DIMENSIONAL STRUCTURE OF DIMERIC HUMAN RECOMBINANT MACROPHAGE COLONY STIMULATING FACTOR Deposited 1993-12-22	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 36–181（146 aa） Chain B 36–181（146 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
3UF2 Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine Deposited 2011-10-31	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain B 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.1M magnesium chloride, 0.1M sodium citrate pH 5.0, 15% w/v PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.75 Å R-free 0.190
3UF2 Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine Deposited 2011-10-31	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain D 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.1M magnesium chloride, 0.1M sodium citrate pH 5.0, 15% w/v PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.75 Å R-free 0.190
3UF2 Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine Deposited 2011-10-31	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain F 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.1M magnesium chloride, 0.1M sodium citrate pH 5.0, 15% w/v PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.75 Å R-free 0.190
3UF2 Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine Deposited 2011-10-31	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain H 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.1M magnesium chloride, 0.1M sodium citrate pH 5.0, 15% w/v PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.75 Å R-free 0.190
3UF2 Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine Deposited 2011-10-31	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain I 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain J 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.1M magnesium chloride, 0.1M sodium citrate pH 5.0, 15% w/v PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.75 Å R-free 0.190
4ADF CRYSTAL STRUCTURE OF THE HUMAN COLONY-STIMULATING FACTOR 1 (hCSF-1) CYTOKINE IN COMPLEX WITH THE VIRAL RECEPTOR BARF1 Deposited 2011-12-23	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain H 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain I 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain J 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain K 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain L 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS HCL, PH 8.50, 1.0 M AMMONIUM PHOSPHATE MONOBASIC	Resolution 4.40 Å R-free 0.276
4ADF CRYSTAL STRUCTURE OF THE HUMAN COLONY-STIMULATING FACTOR 1 (hCSF-1) CYTOKINE IN COMPLEX WITH THE VIRAL RECEPTOR BARF1 Deposited 2011-12-23	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain S 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain T 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain U 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain V 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain W 33–181（149 aa） Fragment：UNP RESIDUES 33-181 Chain X 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS HCL, PH 8.50, 1.0 M AMMONIUM PHOSPHATE MONOBASIC	Resolution 4.40 Å R-free 0.276
4FA8 Multi-pronged modulation of cytokine signaling Deposited 2012-05-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain E 36–180（145 aa） Fragment：UNP residues 36-180 Chain F 36–180（145 aa） Fragment：UNP residues 36-180 Chain G 36–180（145 aa） Fragment：UNP residues 36-180	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；8% PEG8000, 0.1M imidazole pH8.0, 0.22M calcium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.260
4FA8 Multi-pronged modulation of cytokine signaling Deposited 2012-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 36–180（145 aa） Fragment：UNP residues 36-180	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；8% PEG8000, 0.1M imidazole pH8.0, 0.22M calcium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.260
4FA8 Multi-pronged modulation of cytokine signaling Deposited 2012-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain F 36–180（145 aa） Fragment：UNP residues 36-180 Chain G 36–180（145 aa） Fragment：UNP residues 36-180	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；8% PEG8000, 0.1M imidazole pH8.0, 0.22M calcium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.260
4WRL Structure of the human CSF-1:CSF-1R complex Deposited 2014-10-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 33–181（149 aa） Fragment：UNP residues 33-181 Chain D 33–181（149 aa） Fragment：UNP residues 33-181	Not recorded	SIA N-acetyl-alpha-neuraminic acid × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.2 M Lithium sulfate monohydrate, 0.1 M Tris pH 8.5 and 28% w/v PEG 3350	Resolution 2.80 Å R-free 0.261
4WRM Structure of the human CSF-1:CSF-1R complex Deposited 2014-10-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 33–181（149 aa） Fragment：UNP RESIDUES 33-181	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；0.1 M NaCl, 0.1 M Tris pH 8.0 and 8% w/v PEG 20000	Resolution 6.85 Å R-free 0.359
5LXF Crystal structure of the human Macrophage Colony Stimulating Factor M- CSF_C31S variant Deposited 2016-09-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 33–190（158 aa） Chain B 33–190（158 aa）	Mutation：C31S Mutation：C31S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；293 K；0.03M Bis-Tris pH 6.5; 0.17M Mg Formate; 16.67% PEG 3350; 0.07M Bis-Tris pH 5.5	Resolution 2.00 Å R-free 0.253

7 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CSF1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 5–153； UniProt 33–181 Author chain F； PDBConstruct 5–153； UniProt 33–181 Author chain G； PDBConstruct 5–153； UniProt 33–181 Author chain H； PDBConstruct 5–153； UniProt 33–181

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3uez
Deposition date deposition_date	2011-10-31
Structure title title	Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine in complex with the viral receptor BARF1
Keywords keywords	;VIRAL RECEPTOR, RTKIII, EXTRACELLULAR, CYTOKINE RECEPTOR-CYTOKINE complex, CYTOKINE, FOUR-HELIX BUNDLE, GLYCOPROTEIN, IMMUNOGLOBULIN DOMAIN, ONCOGENE, RECEPTOR, CYTOKINE/SIGNALING, PROTEIN COMPLEX ;; CYTOKINE RECEPTOR/CYTOKINE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	41.68 Å
Radius of gyration Rg (electron density) rg_electron	41.42 Å
Forward intensity I(0) i0	343615000.00
Molecular weight molecular_weight	151990.0 kDa
Excluded volume excluded_volume	190560 Å³
Envelope volume envelope_volume	282640 Å³
Hydration-shell volume shell_volume	57477 Å³
Envelope diameter envelope_diameter	143.1 Å
Shell Rg shell_rg	45.59 Å
Envelope Rg envelope_rg	41.21 Å
Shape Rg shape_rg	41.44 Å
Total Rg total_rg	41.63 Å
Total atoms total_atoms	10687
Residues n_residues	1307
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	133.2 Å
Rg (real space) rg_real	41.55 Å
Rg uncertainty (real space) rg_real_error	0.99 Å
I(0) (real space) i0_real	3.4360e+08
I(0) uncertainty (real space) i0_real_error	6.3370e+06
Rg (reciprocal space) rg_reciprocal	41.67 Å
I(0) (reciprocal space) i0_reciprocal	343700000.0000
Solution quality estimate total_estimate	0.8976
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	52.6 Å
Skewness Skewness skewness	0.170
Kurtosis Kurtosis kurtosis	-0.474
Angular range angular_range	— – 0.1900 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	16370000.0000
Real-space data points n_real_points	39
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.920; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.991; Smooth: 0.915

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Secreted protein BARF1
Molecular weight formula_weight	23412.7 kDa
Mutation mutation	T169S
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	10693

VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPSAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQKHHHHHH

来源 Source

来源生物 organism	Human herpesvirus 4
通用名 common_name	HHV-4
NCBI Class编号 ncbi_taxonomy_id	10377
宿主生物 host_organism	Homo Sapiens

Entity 2 Entity 2 polymer

Description description	Macrophage colony-stimulating factor 1
Molecular weight formula_weight	17868.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

GSHMEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	4

▼

7. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	3uezA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezD01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3uezE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3uezF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3uezG00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3uezH00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	235.240 Å
Unit-cell length b length_b	235.240 Å
Unit-cell length c length_c	95.710 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	3.414 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.2336
R_work r_work	0.2314
R_free r_free	0.2735

fit	/app/data/saxs_computation/ue/3uez/3uez.fit
pddf	/app/data/pr_computation/ue/3uez/3uez.pr.out
profile	/app/data/saxs_computation/ue/3uez/3uez.dat

Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine in complex with the viral receptor BARF1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted protein BARF1

State in the Current Structure

Other States of the Same Protein in the Database

Macrophage colony-stimulating factor 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 branched

7. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)