SAXSdb — 3uit

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ACETATE ION × 8 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ACETATE ION × 5 water × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	ACETATE ION × 2 water × 1	Consistent with protein count
4	Insufficient information	Monomer	Protein 1	ACETATE ION × 5 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INADL_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–68； UniProt 1–68 Author chain B； PDBConstruct 1–68； UniProt 1–68 Author chain C； PDBConstruct 1–68； UniProt 1–68 Author chain D； PDBConstruct 1–68； UniProt 1–68

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

Homo sapiens

UniProt Q8N3R9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ACETATE ION × 8 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ACETATE ION × 5 water × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	ACETATE ION × 2 water × 1	Consistent with protein count
4	Insufficient information	Monomer	Protein 1	ACETATE ION × 5 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MPP5_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 77–190； UniProt 119–232 Author chain B； PDBConstruct 77–190； UniProt 119–232 Author chain C； PDBConstruct 77–190； UniProt 119–232 Author chain D； PDBConstruct 77–190； UniProt 119–232

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

Homo sapiens

UniProt Q9Z252

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ACETATE ION × 8 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ACETATE ION × 5 water × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	ACETATE ION × 2 water × 1	Consistent with protein count
4	Insufficient information	Monomer	Protein 1	ACETATE ION × 5 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LIN7B_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 202–265； UniProt 3–66 Author chain B； PDBConstruct 202–265； UniProt 3–66 Author chain C； PDBConstruct 202–265； UniProt 3–66 Author chain D； PDBConstruct 202–265； UniProt 3–66

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3uit
Deposition date deposition_date	2011-11-06
Structure title title	Overall structure of Patj/Pals1/Mals complex
Keywords keywords	L27 domain, CELL POLARIZATION, CELL ADHESION; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3uit__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3uit__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3uit__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.17 Å
Rg (electron density)	23.39 Å
Total Rg	24.28 Å
Atom count	2059
Residues	256
Excluded volume	36893 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3uit__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3uit__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3uit__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3uit__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B
Molecular weight formula_weight	29856.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	9047

MPENPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLSHIPLEVLFQGPVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMGGGLEVLFQGPALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	mouse, human, rat
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	864

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	3uitA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	360 —

Domain ID domain_id	3uitA02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1270 — Substrate Binding Domain Of Dnak; Chain:A; Domain 2
Homologous superfamily homologous superfamily	460 —

Domain ID domain_id	3uitB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	360 —

Domain ID domain_id	3uitB02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1270 — Substrate Binding Domain Of Dnak; Chain:A; Domain 2
Homologous superfamily homologous superfamily	460 —

Domain ID domain_id	3uitC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	360 —

Domain ID domain_id	3uitC02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1270 — Substrate Binding Domain Of Dnak; Chain:A; Domain 2
Homologous superfamily homologous superfamily	460 —

Domain ID domain_id	3uitD01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	360 —

Domain ID domain_id	3uitD02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1270 — Substrate Binding Domain Of Dnak; Chain:A; Domain 2
Homologous superfamily homologous superfamily	460 —

▶

Unit-cell length a length_a	145.194 Å
Unit-cell length b length_b	145.194 Å
Unit-cell length c length_c	202.547 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 61 2 2
Space-group number int_tables_number	178
Crystal system crystal_system	—

Resolution resolution	2.050 Å
Low-resolution limit resolution_low	38.863 Å
R factor r_factor	0.1817
R_work r_work	0.1797
R_free r_free	0.2205

Overall structure of Patj/Pals1/Mals complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

State in the Current Structure

Other States of the Same Protein in the Database

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

State in the Current Structure

Other States of the Same Protein in the Database

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3uit__assembly_1__model_1

3uit__assembly_1__model_1 | I(q)

3uit__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Overall structure of Patj/Pals1/Mals complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3uit__assembly_1__model_1

3uit__assembly_1__model_1 | I(q)

3uit__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)