SAXSdb — 7ntk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAGUK p55 subfamily member 5

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Envelope small membrane protein × 1 （P0DTC4） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Envelope small membrane protein × 1 （P0DTC4） CITRATE ANION × 1 1,2-ETHANEDIOL × 3 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Envelope small membrane protein × 1 （P0DTC4） 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Envelope small membrane protein × 1 （P0DTC4） 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MPP5_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–87； UniProt 255–336 Author chain B； PDBConstruct 6–87； UniProt 255–336 Author chain D； PDBConstruct 6–87； UniProt 255–336 Author chain F； PDBConstruct 6–87； UniProt 255–336

Envelope small membrane protein

OrganismNot specified

UniProt P0DTC4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MAGUK p55 subfamily member 5 × 1 （Q8N3R9） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	MAGUK p55 subfamily member 5 × 1 （Q8N3R9） CITRATE ANION × 1 1,2-ETHANEDIOL × 3 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	MAGUK p55 subfamily member 5 × 1 （Q8N3R9） 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	MAGUK p55 subfamily member 5 × 1 （Q8N3R9） 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VEMP_SARS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–8； UniProt 68–75 Author chain E； PDBConstruct 1–8； UniProt 68–75 Author chain G； PDBConstruct 1–8； UniProt 68–75 Author chain H； PDBConstruct 1–8； UniProt 68–75

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ntk
Deposition date deposition_date	2021-03-10
Structure title title	PALS1 PDZ1 domain with SARS-CoV-2_E PBM complex
Keywords keywords	cell polarity, PALS1, SARS-CoV-2_E, CELL ADHESION; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ntk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ntk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ntk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	13.62 Å
Rg (electron density)	11.94 Å
Total Rg	13.39 Å
Atom count	1368
Residues	93
Excluded volume	12246 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ntk__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7ntk__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`7ntk__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`7ntk__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	MAGUK p55 subfamily member 5
Molecular weight formula_weight	9391.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,F
Atom count atom_count	6020

GPLGSKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Envelope small membrane protein
Molecular weight formula_weight	899.1 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,E,G,H

SRVPDLLV

Entity 3 Entity 3 non-polymer

Description description	CITRATE ANION
Molecular weight formula_weight	189.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	359

▶

Unit-cell length a length_a	28.688 Å
Unit-cell length b length_b	103.762 Å
Unit-cell length c length_c	59.076 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.98 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	29.610 Å
R factor r_factor	0.1975
R_work r_work	0.1957
R_free r_free	0.2287

PALS1 PDZ1 domain with SARS-CoV-2_E PBM complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAGUK p55 subfamily member 5

State in the Current Structure

Other States of the Same Protein in the Database

Envelope small membrane protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ntk__assembly_1__model_1

7ntk__assembly_1__model_1 | I(q)

7ntk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

PALS1 PDZ1 domain with SARS-CoV-2_E PBM complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAGUK p55 subfamily member 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Envelope small membrane protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ntk__assembly_1__model_1

7ntk__assembly_1__model_1 | I(q)

7ntk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)