SAXSdb — 4bmj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

TAX1-BINDING PROTEIN 1

HOMO SAPIENS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
10	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
11	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 2 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
8	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count
9	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CHLORIDE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAXB1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–69； UniProt 725–789 Author chain B； PDBConstruct 5–69； UniProt 725–789 Author chain C； PDBConstruct 5–69； UniProt 725–789 Author chain D； PDBConstruct 5–69； UniProt 725–789 Author chain E； PDBConstruct 5–69； UniProt 725–789 Author chain F； PDBConstruct 5–69； UniProt 725–789 Author chain G； PDBConstruct 5–69； UniProt 725–789 Author chain H； PDBConstruct 5–69； UniProt 725–789 Author chain I； PDBConstruct 5–69； UniProt 725–789 Author chain J； PDBConstruct 5–69； UniProt 725–789 Author chain K； PDBConstruct 5–69； UniProt 725–789

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4bmj
Deposition date deposition_date	2013-05-09
Structure title title	Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1
Keywords keywords	APOPTOSIS, UBZ DOMAINS, UBIQUITIN, INFLAMMATION; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4bmj__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4bmj__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4bmj__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.70 Å
Rg (electron density)	15.22 Å
Total Rg	15.91 Å
Atom count	500
Residues	58
Excluded volume	8737 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4bmj__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4bmj__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4bmj__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4bmj__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4bmj__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4bmj__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4bmj__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4bmj__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`4bmj__assembly_9__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`4bmj__assembly_10__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`4bmj__assembly_11__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	TAX1-BINDING PROTEIN 1
Molecular weight formula_weight	8332.3 kDa
Source method src_method	man
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K
Atom count atom_count	5887

GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	92

▼

6. Fold Classification (SCOP + CATH) 11 domains

CATH v4.4 (11 domains)

Domain ID domain_id	4bmjA00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjB00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjC00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjD00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjE00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjF00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjG00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjH00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjI00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjJ00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	4bmjK00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	250 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	40 —

▶

Unit-cell length a length_a	118.878 Å
Unit-cell length b length_b	118.878 Å
Unit-cell length c length_c	327.345 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	132

Space group space_group	P 65 2 2
Space-group number int_tables_number	179
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	103.140 Å
R factor r_factor	0.2167
R_work r_work	0.2147
R_free r_free	0.2546

Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1

1. Protein Identity and Related Structures Protein Identity & Related Structures

TAX1-BINDING PROTEIN 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4bmj__assembly_4__model_1

4bmj__assembly_4__model_1 | I(q)

4bmj__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 11 domains

CATH v4.4 (11 domains)

7. Citations (1)

Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1

1. Protein Identity and Related Structures Protein Identity & Related Structures

TAX1-BINDING PROTEIN 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4bmj__assembly_4__model_1

4bmj__assembly_4__model_1 | I(q)

4bmj__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 11 domains

CATH v4.4 (11 domains)

7. Citations (1)