8w6a

Crystal structure of TAX1BP1 LIR region in complex with GABARAP

Method: X-RAY DIFFRACTION D_max: 92.7 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-aminobutyric acid receptor-associated protein

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–117	Not recorded	Tax1-binding protein 1 × 1 （Q86VP1）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–117	Not recorded	Tax1-binding protein 1 × 1 （Q86VP1）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 1–117	Not recorded	Tax1-binding protein 1 × 1 （Q86VP1）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 1–117	Not recorded	Tax1-binding protein 1 × 1 （Q86VP1）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8W6A	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1GNU GABA(A) receptor associated protein GABARAP Deposited 2001-10-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；18MG/ML GABARAP, 50MM TRIS PH8.5, 0.25M NACL,10%(W/V) PEGMONO, pH 8.50	Resolution 1.75 Å R-free 0.230
1KLV Solution Structure and Backbone Dynamics of GABARAP, GABAA Receptor associated protein Deposited 2001-12-13	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 340；Pressure 1 NMR sample composition 1mM GABARAP, 20mM phosphate buffer NA, 50mM NaCl, 0.02mM NaN3, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 1mM GABARAP, 20mM phosphate buffer NA, 50mM NaCl, 0.02mM NaN3, 100% D2O \| 100% D2O	Resolution not provided
1KM7 Solution Structure and Backbone Dynamics of GABARAP, GABAA Receptor Associated Protein Deposited 2001-12-14	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 340；Pressure 1 NMR sample composition 1mM GABARAP, 20mM phosphate buffer NA, 50mM NaCl, 0.02mM NaN3, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 1mM GABARAP, 20mM phosphate buffer NA, 50mM NaCl, 0.02mM NaN3, 100% D2O \| 100% D2O	Resolution not provided
1KOT Solution Structure of Human GABA Receptor Associated Protein GABARAP Deposited 2001-12-22	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.9；298 K；Ionic strength (raw mmCIF value) 100mM NaCl 100mM KCl；Pressure ambient NMR sample composition 0.8mM GABARAP U-15N,13C; 25mM sodium oxalate, pH 6.9 100mM NaCl 100mM KCl 100uM PMSF 0.02% sodium azide 50uM EDTA 5% D2O, 95% H2O \| 95% H2O/5% D2O NMR sample composition 0.8mM GABARAP U-15N,13C; 25mM sodium phosphate, pH 6.9 100mM NaCl 100mM KCl 100uM PMSF 0.02% sodium azide 50uM EDTA 100% D2O \| 100% D2O	Resolution not provided
3D32 Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide Deposited 2008-05-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	NA SODIUM ION × 1 CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.9；285 K；30 % (w/v) PEG3350 800 mM NaCl 50 mM MES, pH 5.9, VAPOR DIFFUSION, temperature 285K	Resolution 1.30 Å R-free 0.195
3D32 Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide Deposited 2008-05-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–117（117 aa）	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.9；285 K；30 % (w/v) PEG3350 800 mM NaCl 50 mM MES, pH 5.9, VAPOR DIFFUSION, temperature 285K	Resolution 1.30 Å R-free 0.195
3DOW Complex structure of GABA type A receptor associated protein and its binding epitope on calreticulin Deposited 2008-07-07	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；290 K；0.1 M MES, 27% v/v PEG MME 550, 10 mM ZnSO4, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.30 Å R-free 0.270
3WIM GABARAP-LIR peptide complex Deposited 2013-09-19	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.4；293 K；2M ammonium sulfate, 0.1M sodium citrate, 0.2M potassium sodium tartrate, pH 5.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.296
5DPS Crystal structure of PLEKHM1 LIR-fused human GABARAP_2-117 Deposited 2015-09-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–117（116 aa） Fragment：UNP Q9Y4G2 residues 627-638, UNP O95166 residues 2-117	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；278 K；4% v/v Tacsimate pH 8.0, 12% w/v Polyethylene glycol 3,350	Resolution 2.00 Å R-free 0.223
5DPS Crystal structure of PLEKHM1 LIR-fused human GABARAP_2-117 Deposited 2015-09-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–117（116 aa） Fragment：UNP Q9Y4G2 residues 627-638, UNP O95166 residues 2-117	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；278 K；4% v/v Tacsimate pH 8.0, 12% w/v Polyethylene glycol 3,350	Resolution 2.00 Å R-free 0.223
5DPS Crystal structure of PLEKHM1 LIR-fused human GABARAP_2-117 Deposited 2015-09-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2–117（116 aa） Fragment：UNP Q9Y4G2 residues 627-638, UNP O95166 residues 2-117	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；278 K；4% v/v Tacsimate pH 8.0, 12% w/v Polyethylene glycol 3,350	Resolution 2.00 Å R-free 0.223
6HB9 Crystal structure of the GABARAP in complex with the UBA5 LIR motif Deposited 2018-08-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–116（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.6 M sodium phosphate, 0.1 M HEPES, pH7.5	Resolution 1.30 Å R-free 0.213
6HOG Structure of VPS34 LIR motif bound to GABARAP Deposited 2018-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–112（112 aa）	Not recorded	SO4 SULFATE ION × 6 EDO 1,2-ETHANEDIOL × 6 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；50 mM HEPES pH 7.1, 40% PEG 600	Resolution 1.26 Å R-free 0.181
6HOH Structure of VPS34 LIR motif (S249E) bound to GABARAP Deposited 2018-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–112（112 aa）	Not recorded	PGE TRIETHYLENE GLYCOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG 3350, 200 mM magnesium formate	Resolution 2.25 Å R-free 0.250
6HOH Structure of VPS34 LIR motif (S249E) bound to GABARAP Deposited 2018-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain B 1–112（112 aa） Chain C 1–112（112 aa） Chain D 1–112（112 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG 3350, 200 mM magnesium formate	Resolution 2.25 Å R-free 0.250
6HOJ Structure of Beclin1 LIR motif bound to GABARAP Deposited 2018-09-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–112（112 aa） Chain B 1–112（112 aa） Chain C 1–112（112 aa）	Not recorded	SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；15% PEG 4000, 50 mM Bicine pH 8.8	Resolution 1.51 Å R-free 0.211
6HOK Structure of Beclin1 LIR (S96E) motif bound to GABARAP Deposited 2018-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–112（112 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.6 M ammonium sulfate, 100 mM TRIS pH 8.5, 10 % Glycerol	Resolution 1.61 Å R-free 0.198
6HYL Structure of PCM1 LIR motif bound to GABARAP Deposited 2018-10-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M CaCl2, 0.1 M HEPES pH 7, 20% w/v PEG 6000	Resolution 1.56 Å R-free 0.247
6HYL Structure of PCM1 LIR motif bound to GABARAP Deposited 2018-10-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M CaCl2, 0.1 M HEPES pH 7, 20% w/v PEG 6000	Resolution 1.56 Å R-free 0.247
6HYM Structure of PCM1 LIR motif bound to GABARAP Deposited 2018-10-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% w/v PEG 1500, 0.1 M SPG pH 8.5	Resolution 1.86 Å R-free 0.217
6HYM Structure of PCM1 LIR motif bound to GABARAP Deposited 2018-10-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–117（117 aa）	Not recorded	GOL GLYCEROL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% w/v PEG 1500, 0.1 M SPG pH 8.5	Resolution 1.86 Å R-free 0.217
6HYN Structure of ATG13 LIR motif bound to GABARAP Deposited 2018-10-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M NaCl, 10% PEG 8000, 0.1M Na K phosphate 6.2	Resolution 1.14 Å R-free 0.185
6HYO Structure of ULK1 LIR motif bound to GABARAP Deposited 2018-10-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	GOL GLYCEROL × 1 PEG DI(HYDROXYETHYL)ETHER × 6 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M MgCl2. 0.1 M Na cacodylate pH 6.5, 20% PEG1000	Resolution 1.07 Å R-free 0.161
6YOP Structure of SAMM50 LIR bound to GABARAP Deposited 2020-04-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% v/v isopropanol, 0.1 M Na Acetate pH 5.5	Resolution 1.10 Å R-free 0.159
7AA8 Structure of SCOC LIR bound to GABARAP Deposited 2020-09-03	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.4；293 K；2.9% PEG 550 MME, 50 mM Bicine pH 8.4, 30% PEG 1500	Resolution 1.25 Å R-free 0.194
7BRQ Crystal structure of human FAM134B LIR fused to human GABARAP Deposited 2020-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–116（116 aa）	Mutation：F3S,V4T	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；1.91 M ammonium sulfate, 0.1 M sodium citrate pH 5.5, 0.18 M potassium sodium tartrate	Resolution 1.40 Å R-free 0.206
7BRT Crystal structure of Sec62 LIR fused to GABARAP Deposited 2020-03-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–116（116 aa） Chain B 1–116（116 aa）	Mutation：T367D,F3S,V4T Mutation：T367D,F3S,V4T	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；1.5 M ammonium sulfate, 0.1 M Tris pH 8.5	Resolution 2.00 Å R-free 0.184
7BRU Crystal structure of human RTN3 LIR fused to human GABARAP Deposited 2020-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–116（116 aa） Chain B 1–116（116 aa） Chain C 1–116（116 aa）	Mutation：F3S,V4T Mutation：F3S,V4T Mutation：F3S,V4T	PO4 PHOSPHATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.8 M potassium phosphate monobasic, 0.8 M sodium phosphate monobasic, 0.1 M HEPES pH 7.5	Resolution 2.15 Å R-free 0.230
7BV4 Crystal structure of STX17 LIR region in complex with GABARAP Deposited 2020-04-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.12M Alcohols, 50% (v/v) Precipitant Mix 4, Buffer System 3 at pH 8.5 in Morpheus screen kit from Molecular Dimension	Resolution 2.00 Å R-free 0.225
7BV4 Crystal structure of STX17 LIR region in complex with GABARAP Deposited 2020-04-09	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.12M Alcohols, 50% (v/v) Precipitant Mix 4, Buffer System 3 at pH 8.5 in Morpheus screen kit from Molecular Dimension	Resolution 2.00 Å R-free 0.225
7BV4 Crystal structure of STX17 LIR region in complex with GABARAP Deposited 2020-04-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–117（117 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.12M Alcohols, 50% (v/v) Precipitant Mix 4, Buffer System 3 at pH 8.5 in Morpheus screen kit from Molecular Dimension	Resolution 2.00 Å R-free 0.225
7BV4 Crystal structure of STX17 LIR region in complex with GABARAP Deposited 2020-04-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–117（117 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.12M Alcohols, 50% (v/v) Precipitant Mix 4, Buffer System 3 at pH 8.5 in Morpheus screen kit from Molecular Dimension	Resolution 2.00 Å R-free 0.225
7EA7 crystal structure of NAP1 LIR in complex with GABARAP Deposited 2021-03-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.3 M sodium nitrate, 0.3 M sodium phosphate dibasic, 0.3 M ammonium sulfate, 0.1 M bicine-tris pH 8.5, 25% v/v MPD, 25% PEG1000, 25% w/v PEG3350	Resolution 2.69 Å R-free 0.271
7EA7 crystal structure of NAP1 LIR in complex with GABARAP Deposited 2021-03-06	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.3 M sodium nitrate, 0.3 M sodium phosphate dibasic, 0.3 M ammonium sulfate, 0.1 M bicine-tris pH 8.5, 25% v/v MPD, 25% PEG1000, 25% w/v PEG3350	Resolution 2.69 Å R-free 0.271
7LSW Structure of Full Beta-Hairpin LIR from FNIP2 Bound to GABARAP Deposited 2021-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa） Chain C 1–117（117 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；2.0 M ammonium sulfate, 0.1 M HEPES pH 7.5, and 2% v/v PEG 550 MME	Resolution 3.05 Å R-free 0.247
7LSW Structure of Full Beta-Hairpin LIR from FNIP2 Bound to GABARAP Deposited 2021-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 1–117（117 aa） Chain D 1–117（117 aa）	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；2.0 M ammonium sulfate, 0.1 M HEPES pH 7.5, and 2% v/v PEG 550 MME	Resolution 3.05 Å R-free 0.247
7LSW Structure of Full Beta-Hairpin LIR from FNIP2 Bound to GABARAP Deposited 2021-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 1–117（117 aa） Chain E 1–117（117 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；2.0 M ammonium sulfate, 0.1 M HEPES pH 7.5, and 2% v/v PEG 550 MME	Resolution 3.05 Å R-free 0.247
7LSW Structure of Full Beta-Hairpin LIR from FNIP2 Bound to GABARAP Deposited 2021-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–117（117 aa） Chain F 1–117（117 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；2.0 M ammonium sulfate, 0.1 M HEPES pH 7.5, and 2% v/v PEG 550 MME	Resolution 3.05 Å R-free 0.247
7LT6 Structure of Partial Beta-Hairpin LIR from FNIP2 Bound to GABARAP Deposited 2021-02-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–117（117 aa） Chain B 1–117（117 aa） Chain C 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；0.1 M magnesium acetate, 0.1 M MOPS pH 7.5, and 12% v/v PEG 8000	Resolution 1.80 Å R-free 0.273
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 11 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VEC Crystal structure of GABARAP complexed with the TEX264 LIR phosphorylated at Ser271 and Ser272 Deposited 2021-09-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 1–116（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG 4000, 0.2M ammonium acetate, 0.1M bis-Tris pH 5.6	Resolution 3.00 Å R-free 0.301
7VED Crystal structure of GABARAP fused to TEX264 LIR with S272D mutation Deposited 2021-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–116（116 aa）	Mutation：S272D,F3S,V4T	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M potassium sodium tartrate, 0.1M sodium citrate pH 5.6, 2.0M ammonium sulfate	Resolution 2.02 Å R-free 0.225
7VED Crystal structure of GABARAP fused to TEX264 LIR with S272D mutation Deposited 2021-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–116（116 aa）	Mutation：S272D,F3S,V4T	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M potassium sodium tartrate, 0.1M sodium citrate pH 5.6, 2.0M ammonium sulfate	Resolution 2.02 Å R-free 0.225
7YO9 Crystal structure of fusion protein of human TP53INP2 LIR and human GABARAP Deposited 2022-08-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–116（116 aa） Fragment：Tumor protein p53-inducible nuclear protein 2(1-15), Gamma-aminobutyric acid receptor-associated protein(16-131)	Mutation：F18S,V19T	IPA ISOPROPYL ALCOHOL × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293 K；10% 2-propanol, 0.1 M sodium phosphate/citric acid pH 4.2, 0.2 M lithium sulfate	Resolution 1.75 Å R-free 0.216
7ZKR Human GABARAP in complex with stapled peptide Pen3-ortho Deposited 2022-04-13	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	PO4 PHOSPHATE ION × 3 CL CHLORIDE ION × 1 OXE ORTHO-XYLENE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；magnesium acetate, sodium cacodylate, PEG 8000	Resolution 1.10 Å R-free 0.167
7ZL7 Human GABARAP in complex with stapled peptide Pen8-ortho Deposited 2022-04-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	CL CHLORIDE ION × 4 NA SODIUM ION × 1 OXE ORTHO-XYLENE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；sodium chloride, Tris-HCl, PEG 3000	Resolution 1.55 Å R-free 0.220
7ZL7 Human GABARAP in complex with stapled peptide Pen8-ortho Deposited 2022-04-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–117（117 aa）	Not recorded	CL CHLORIDE ION × 4 OXE ORTHO-XYLENE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；sodium chloride, Tris-HCl, PEG 3000	Resolution 1.55 Å R-free 0.220
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–116（115 aa）	Not recorded	ACT ACETATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–116（115 aa）	Not recorded	ACT ACETATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2–116（115 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 2–116（115 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 2–116（115 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 2–116（115 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 2–116（115 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8AFI GABARAP in complex with LIR motif of HsATG3 Deposited 2022-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 2–116（115 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium acetate, sodium cacodylate, PEG 8,000	Resolution 2.66 Å R-free 0.262
8S1M Crystal structure of human GABARAP fused to EGFR (1076-1099) Deposited 2024-02-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；0.17 M ammonium acetate 0.085 M sodium citrate 25.5% PEG 4000 15% Glycerol	Resolution 2.05 Å R-free 0.230
8T2M Crystal structure of GABARAP in complex with the LIR of NSs4 Deposited 2023-06-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa） Fragment：;GS is the remain of the removed expression tag. The C terminus of Nss 257-265 has been fused with Q9H492 to facilitate the crystalization. The GG is a spacer between Nss and GABARAP protein. ;	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate:HCl, pH 4.6, 8% PEG 4000	Resolution 1.27 Å R-free 0.178
8T2N Crystal structure of GABARAP in complex with the LIR of NSs3 Deposited 2023-06-06	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Potassium acetate, 20% PEG 3350	Resolution 1.88 Å R-free 0.264
8T2N Crystal structure of GABARAP in complex with the LIR of NSs3 Deposited 2023-06-06	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Potassium acetate, 20% PEG 3350	Resolution 1.88 Å R-free 0.264
8T31 Crystal structure of GABARAP in complex with the LIR of TP53INP2/DOR Deposited 2023-06-07	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25% PEG3350, 0.1M Na-citrate, 5% isopropanol	Resolution 2.10 Å R-free 0.264
8T31 Crystal structure of GABARAP in complex with the LIR of TP53INP2/DOR Deposited 2023-06-07	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25% PEG3350, 0.1M Na-citrate, 5% isopropanol	Resolution 2.10 Å R-free 0.264
8T31 Crystal structure of GABARAP in complex with the LIR of TP53INP2/DOR Deposited 2023-06-07	Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25% PEG3350, 0.1M Na-citrate, 5% isopropanol	Resolution 2.10 Å R-free 0.264
8T31 Crystal structure of GABARAP in complex with the LIR of TP53INP2/DOR Deposited 2023-06-07	Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25% PEG3350, 0.1M Na-citrate, 5% isopropanol	Resolution 2.10 Å R-free 0.264
8T31 Crystal structure of GABARAP in complex with the LIR of TP53INP2/DOR Deposited 2023-06-07	Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 1–117（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25% PEG3350, 0.1M Na-citrate, 5% isopropanol	Resolution 2.10 Å R-free 0.264
8T32 Crystal structure of K48 acetylated GABARAP in complex with the LIR of TP53INP2/DOR Deposited 2023-06-07	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；28 % (w/v) PEG 2000 MME, 0.1 M Bis-Tris: HCl, pH 6.5	Resolution 2.05 Å R-free 0.271
8T33 Crystal structure of K46 acetylated GABARAP in complex with the LIR of TP53INP2/DOR Deposited 2023-06-07	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 9 ACT ACETATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；10 % w/v PEG 3000, 0.2 M Zinc acetate dihydrate, 0.1 M Sodium acetate PH 4.5	Resolution 1.60 Å R-free 0.212
9E8P Crystal Structure of GABARAP-ATG3 conjugate Deposited 2024-11-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–116（116 aa）	Not recorded	SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277.15 K；0.1 mM Tris pH8.5, 25%(w/v) PEG3550	Resolution 2.70 Å R-free 0.249
9E8P Crystal Structure of GABARAP-ATG3 conjugate Deposited 2024-11-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–116（116 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277.15 K；0.1 mM Tris pH8.5, 25%(w/v) PEG3550	Resolution 2.70 Å R-free 0.249
9HGD Crystal structure of human GABARAP in complex with cyclic peptide GAB_D23 Deposited 2024-11-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	CL CHLORIDE ION × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.1 M MES pH 5, 30% PEG 6000	Resolution 1.50 Å R-free 0.222
9HGD Crystal structure of human GABARAP in complex with cyclic peptide GAB_D23 Deposited 2024-11-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–117（117 aa）	Not recorded	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.1 M MES pH 5, 30% PEG 6000	Resolution 1.50 Å R-free 0.222
9I9X Human GABARAP in complex with artificial peptide IM-2 Deposited 2025-02-07	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–117（117 aa）	Not recorded	GOL GLYCEROL × 3 DMS DIMETHYL SULFOXIDE × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；ammonium sulfate, sodium cacodylate trihydrate, PEG 8000, DMSO, Tris-HCl, NaCl	Resolution 1.42 Å R-free 0.197

41 other PDB entries and 81 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GBRAP_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–117； UniProt 1–117 Author chain B； PDBConstruct 1–117； UniProt 1–117 Author chain D； PDBConstruct 1–117； UniProt 1–117 Author chain G； PDBConstruct 1–117； UniProt 1–117

Tax1-binding protein 1

Homo sapiens

UniProt Q86VP1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 123–151	Not recorded	Gamma-aminobutyric acid receptor-associated protein × 1 （O95166）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 123–151	Not recorded	Gamma-aminobutyric acid receptor-associated protein × 1 （O95166）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 123–151	Not recorded	Gamma-aminobutyric acid receptor-associated protein × 1 （O95166）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain H； UniProt 123–151	Not recorded	Gamma-aminobutyric acid receptor-associated protein × 1 （O95166）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；2.8 M Sodium acetate trihydrate and 0.1 M BIS-TRIS propane at pH 7.0	Resolution 1.53 Å R-free 0.187

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8W6A	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2M7Q Solution structure of TAX1BP1 UBZ1+2 Deposited 2013-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 725–789（65 aa） Fragment：UNP residues 725-789	Not recorded	ZN ZINC ION × 2	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 0；Pressure ambient NMR sample composition 0.5-1.0 mM [U-98% 13C; U-98% 15N] UBZ1+2-1, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain J 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 11 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4BMJ Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1 Deposited 2013-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 725–789（65 aa） Fragment：RESIDUES 725-789	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS PH 8.5, 1 M LISO4	Resolution 2.75 Å R-free 0.255
4NLH SKICH domain of human TAX1BP1 Deposited 2013-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 15–147（133 aa） Chain B 15–147（133 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；PEG 3350, MES 7.2, KBr, pH 8.0, vapor diffusion, hanging drop, temperature 298K	Resolution 1.90 Å R-free 0.278
4NLH SKICH domain of human TAX1BP1 Deposited 2013-11-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 15–147（133 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；PEG 3350, MES 7.2, KBr, pH 8.0, vapor diffusion, hanging drop, temperature 298K	Resolution 1.90 Å R-free 0.278
4NLH SKICH domain of human TAX1BP1 Deposited 2013-11-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 15–147（133 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；PEG 3350, MES 7.2, KBr, pH 8.0, vapor diffusion, hanging drop, temperature 298K	Resolution 1.90 Å R-free 0.278
4Z4K Crystal structure of GFP-TAX1BP1 UBZ1+2 domain fusion protein Deposited 2015-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 725–781（57 aa） Fragment：UBZ1 and UBZ2 Chain B 725–781（57 aa） Fragment：UBZ1 and UBZ2	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.2 M Lithium sulfate monohydrate, 0.1 M Tris pH 8.5, 25% w/v PEG 3350.	Resolution 2.80 Å R-free 0.280
4Z4M Crystal structure of GFP-TAX1BP1 UBZ2 domain fusion protein Deposited 2015-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 755–781（27 aa） Fragment：UBZ2 Chain B 755–781（27 aa） Fragment：UBZ2	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.4；293 K；0.2 M Ammonium fluoride, 20% w/v Polyethylene glycol 3,350	Resolution 2.15 Å R-free 0.298
5AAS The selective autophagy receptor TAX1BP1 is required for autophagy- dependent capture of cytosolic Salmonella typhimurium Deposited 2015-07-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 722–784（63 aa） Fragment：RESIDUES 722-784	Not recorded	ZN ZINC ION × 2	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 100；Pressure 1.0 NMR sample composition 95% WATER/5% D2O	Resolution not provided
5YT6 Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin Deposited 2017-11-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 754–787（34 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；Ammonium sulfate, BIS TRIS propane	Resolution 1.50 Å R-free 0.225
5YT6 Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin Deposited 2017-11-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 754–787（34 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；Ammonium sulfate, BIS TRIS propane	Resolution 1.50 Å R-free 0.225
5YT6 Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin Deposited 2017-11-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 754–787（34 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；Ammonium sulfate, BIS TRIS propane	Resolution 1.50 Å R-free 0.225
5YT6 Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin Deposited 2017-11-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 754–787（34 aa）	Not recorded	ZN ZINC ION × 1 GOL GLYCEROL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；Ammonium sulfate, BIS TRIS propane	Resolution 1.50 Å R-free 0.225
5Z7G Crystal structure of TAX1BP1 SKICH region in complex with NAP1 Deposited 2018-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–121（121 aa） Chain B 1–121（121 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；289 K；PEG 8000, 0.1 M HEPES	Resolution 2.30 Å R-free 0.233
8W6B crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain Deposited 2023-08-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–121（121 aa） Chain B 1–121（121 aa） Chain E 1–121（121 aa） Chain F 1–121（121 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；5% (w/v) PEG 4000, 50 mM Magnesium chloride, 100 mM MES at pH 6.5, 10% 2-propanol	Resolution 2.39 Å R-free 0.234

9 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TAXB1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–29； UniProt 123–151 Author chain E； PDBConstruct 1–29； UniProt 123–151 Author chain F； PDBConstruct 1–29； UniProt 123–151 Author chain H； PDBConstruct 1–29； UniProt 123–151

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8w6a
Deposition date deposition_date	2023-08-28
最后修订 last_revision	2024-07-10
Structure title title	Crystal structure of TAX1BP1 LIR region in complex with GABARAP
Keywords keywords	ATG8, autophagy, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	28.71 Å
Radius of gyration Rg (electron density) rg_electron	27.81 Å
Forward intensity I(0) i0	65747200.00
Molecular weight molecular_weight	66277.0 kDa
Excluded volume excluded_volume	84192 Å³
Envelope volume envelope_volume	105670 Å³
Hydration-shell volume shell_volume	32082 Å³
Envelope diameter envelope_diameter	99.3 Å
Shell Rg shell_rg	34.75 Å
Envelope Rg envelope_rg	27.63 Å
Shape Rg shape_rg	27.78 Å
Total Rg total_rg	28.65 Å
Total atoms total_atoms	4688
Residues n_residues	572
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	92.7 Å
Rg (real space) rg_real	28.63 Å
Rg uncertainty (real space) rg_real_error	0.71 Å
I(0) (real space) i0_real	6.5750e+07
I(0) uncertainty (real space) i0_real_error	9.7920e+05
Rg (reciprocal space) rg_reciprocal	28.66 Å
I(0) (reciprocal space) i0_reciprocal	65750000.0000
Solution quality estimate total_estimate	0.8978
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	40.5 Å
Skewness Skewness skewness	0.189
Kurtosis Kurtosis kurtosis	-0.472
Angular range angular_range	— – 0.2750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	27600000.0000
Real-space data points n_real_points	56
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.896; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.990; Smooth: 0.988

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Gamma-aminobutyric acid receptor-associated protein
Molecular weight formula_weight	13942.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,G
Atom count atom_count	5554

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Tax1-binding protein 1
Molecular weight formula_weight	3109.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,E,F,H

SSPVEELLTMEDEGNSDMLVVTTKAGLLE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	614

▶

8. Citations (1)

▶

Unit-cell length a length_a	141.160 Å
Unit-cell length b length_b	141.160 Å
Unit-cell length c length_c	86.440 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	trigonal

Resolution resolution	1.530 Å
Low-resolution limit resolution_low	26.680 Å
R factor r_factor	0.1746
R_work r_work	0.1740
R_free r_free	0.1868

fit	/app/data/saxs_computation/w6/8w6a/8w6a.fit
pddf	/app/data/pr_computation/w6/8w6a/8w6a.pr.out
profile	/app/data/saxs_computation/w6/8w6a/8w6a.dat

Crystal structure of TAX1BP1 LIR region in complex with GABARAP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-aminobutyric acid receptor-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Tax1-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)