4drb

The crystal structure of FANCM bound MHF complex

Method: X-RAY DIFFRACTION D_max: 132.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere protein S

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain A； UniProt 1–114 Chain B； UniProt 1–114	Fragment：C-terminus deleted, UNP residues 1-114 Non-standard monomer：Yes (specific site not provided by mmCIF)	Fanconi anemia group M protein × 1 （Q8IYD8） Centromere protein X × 2 （A8MT69）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain D； UniProt 1–114 Chain E； UniProt 1–114	Fragment：C-terminus deleted, UNP residues 1-114 Non-standard monomer：Yes (specific site not provided by mmCIF)	Fanconi anemia group M protein × 1 （Q8IYD8） Centromere protein X × 2 （A8MT69）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256
3	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain G； UniProt 1–114 Chain H； UniProt 1–114	Fragment：C-terminus deleted, UNP residues 1-114 Non-standard monomer：Yes (specific site not provided by mmCIF)	Fanconi anemia group M protein × 1 （Q8IYD8） Centromere protein X × 2 （A8MT69）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4DRB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
28OP Structure of the human inner kinetochore CCAN and CENP-C bound to DNA Deposited 2026-02-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 16 PDB declaration: 18-meric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
4DRA Crystal structure of MHF complex Deposited 2012-02-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–107（107 aa） Fragment：C-terminus deleted, UNP residues 1-107 Chain D 1–107（107 aa） Fragment：C-terminus deleted, UNP residues 1-107	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；285 K；0.1M HEPES-NaOH, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.41 Å R-free 0.242
4DRA Crystal structure of MHF complex Deposited 2012-02-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–107（107 aa） Fragment：C-terminus deleted, UNP residues 1-107 Chain C 1–107（107 aa） Fragment：C-terminus deleted, UNP residues 1-107	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；285 K；0.1M HEPES-NaOH, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.41 Å R-free 0.242
4E44 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer Deposited 2012-03-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–110（110 aa） Fragment：UNP residues 1-110 Chain C 1–110（110 aa） Fragment：UNP residues 1-110	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.10 Å R-free 0.231
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–110（110 aa） Fragment：UNP residues 1-110 Chain C 1–110（110 aa） Fragment：UNP residues 1-110	Not recorded	GOL GLYCEROL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain F 1–110（110 aa） Fragment：UNP residues 1-110 Chain H 1–110（110 aa） Fragment：UNP residues 1-110	Not recorded	GOL GLYCEROL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–110（110 aa） Fragment：UNP residues 1-110 Chain M 1–110（110 aa） Fragment：UNP residues 1-110	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain I 14–105（92 aa） Chain J 14–105（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 4 PDB declaration: octameric	Chain K 14–105（92 aa） Chain T 14–105（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain Q 14–105（92 aa） Chain R 14–105（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 14–105（92 aa） Chain S 14–105（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 14–105（92 aa） Chain G 14–105（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NE1 Human MHF1 MHF2 DNA complexes Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain A 14–118（105 aa） Chain C 14–118（105 aa） Chain G 14–118（105 aa） Chain I 14–118（105 aa） Chain J 14–118（105 aa） Chain K 14–118（105 aa） Chain Q 14–118（105 aa） Chain R 14–118（105 aa） Chain S 14–118（105 aa） Chain T 14–118（105 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M ammonium phosphate, Micro-batch under oil, temperature 300K	Resolution 6.50 Å R-free 0.295
4NE1 Human MHF1 MHF2 DNA complexes Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain Y 14–118（105 aa） Chain a 14–118（105 aa） Chain c 14–118（105 aa） Chain e 14–118（105 aa） Chain f 14–118（105 aa） Chain g 14–118（105 aa） Chain k 14–118（105 aa） Chain l 14–118（105 aa） Chain m 14–118（105 aa） Chain n 14–118（105 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M ammonium phosphate, Micro-batch under oil, temperature 300K	Resolution 6.50 Å R-free 0.295
4NE3 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 14–105（92 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.252
4NE5 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 14–105（92 aa） Chain E 14–105（92 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；Micro-batch under oil, temperature 300K	Resolution 2.50 Å R-free 0.264
4NE5 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 14–105（92 aa） Chain G 14–105（92 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；Micro-batch under oil, temperature 300K	Resolution 2.50 Å R-free 0.264
4NE6 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 14–105（92 aa） Chain C 14–105（92 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；Micro-batch under oil, temperature 300K	Resolution 2.10 Å R-free 0.262
7R5S Structure of the human CCAN bound to alpha satellite DNA Deposited 2022-02-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 15 PDB declaration: heptadecameric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.83 Å
7XHN Structure of human inner kinetochore CCAN-DNA complex Deposited 2022-04-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.71 Å
7XHO Structure of human inner kinetochore CCAN complex Deposited 2022-04-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
7YWX Structure of the human CCAN CENP-A alpha-satellite complex Deposited 2022-02-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 25 PDB declaration: 27-meric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
9TAW Structure of the human inner kinetochore CCAN bound to DNA Deposited 2025-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å
9TAX Structure of the human inner kinetochore CCAN bound to a mono-CENP-A nucleosome Deposited 2025-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 25 PDB declaration: 27-meric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
9TAY Structure of the human inner kinetochore CCAN bound to a di-CENP-A nucleosome Deposited 2025-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 35 PDB declaration: 37-meric	Chain S 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.50 Å

16 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CENPS_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–120； UniProt 1–114 Author chain B； PDBConstruct 7–120； UniProt 1–114 Author chain D； PDBConstruct 7–120； UniProt 1–114 Author chain E； PDBConstruct 7–120； UniProt 1–114 Author chain G； PDBConstruct 7–120； UniProt 1–114 Author chain H； PDBConstruct 7–120； UniProt 1–114

Fanconi anemia group M protein

Homo sapiens

UniProt Q8IYD8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain C； UniProt 661–800	Fragment：MHF binding domain, UNP residues 661-800	Centromere protein S × 2 （Q8N2Z9） Centromere protein X × 2 （A8MT69）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain F； UniProt 661–800	Fragment：MHF binding domain, UNP residues 661-800	Centromere protein S × 2 （Q8N2Z9） Centromere protein X × 2 （A8MT69）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256
3	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain I； UniProt 661–800	Fragment：MHF binding domain, UNP residues 661-800	Centromere protein S × 2 （Q8N2Z9） Centromere protein X × 2 （A8MT69）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4DRB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4BXO Architecture and DNA recognition elements of the Fanconi anemia FANCM- FAAP24 complex Deposited 2013-07-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 1798–2048（251 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；18%W/V PEG 3350, 0.2M CALCIUM ACETATE, 0.01M BARIUM CHLORIDE., pH 8.0	Resolution 2.15 Å R-free 0.255
4DAY Crystal structure of the RMI core complex with MM2 peptide from FANCM Deposited 2012-01-13	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1218–1251（34 aa） Fragment：MM2 peptide (residues 1218-1251)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；298 K；200 mM Na2SO4, 5% polyethylene glycol 3350, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.30 Å R-free 0.325
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 667–800（134 aa） Fragment：UNP residues 667-800	Not recorded	GOL GLYCEROL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 667–800（134 aa） Fragment：UNP residues 667-800	Not recorded	GOL GLYCEROL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain O 667–800（134 aa） Fragment：UNP residues 667-800	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4M6W Crystal structure of the C-terminal segment of FANCM in complex with FAAP24 Deposited 2013-08-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1813–2031（219 aa） Fragment：UNP RESIDUES 1813-2031	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；293 K；1.0M (NH4)2SO4, 0.1M HEPES, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.299
9EL5 FANCM translocase domain bound to DNA Deposited 2024-12-03	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 73–644（572 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2 M Sodium chloride, 0.1 M HEPES pH 7.0, 32.5% v/v PEG 400	Resolution 2.20 Å R-free 0.267
9HJO FANCM-FAAP24-dsDNA complex Deposited 2024-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 4 PDB declaration: octameric	Chain A 1815–2048（234 aa） Chain C 1815–2048（234 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% PEG3350 0.1M di-ammonium monohydrogen phosphate	Resolution 2.40 Å R-free 0.265

6 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FANCM_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 2–141； UniProt 661–800 Author chain F； PDBConstruct 2–141； UniProt 661–800 Author chain I； PDBConstruct 2–141； UniProt 661–800

Centromere protein X

Homo sapiens

UniProt A8MT69

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain J； UniProt 1–81 Chain K； UniProt 1–81	Non-standard monomer：Yes (specific site not provided by mmCIF)	Centromere protein S × 2 （Q8N2Z9） Fanconi anemia group M protein × 1 （Q8IYD8）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain L； UniProt 1–81 Chain M； UniProt 1–81	Non-standard monomer：Yes (specific site not provided by mmCIF)	Centromere protein S × 2 （Q8N2Z9） Fanconi anemia group M protein × 1 （Q8IYD8）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256
3	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain N； UniProt 1–81 Chain O； UniProt 1–81	Non-standard monomer：Yes (specific site not provided by mmCIF)	Centromere protein S × 2 （Q8N2Z9） Fanconi anemia group M protein × 1 （Q8IYD8）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；285 K；0.1M Tris-HCl, pH 8.5, 0.2 M (NH4)2SO4, 25% PEG 3350 , VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.63 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4DRB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
28OP Structure of the human inner kinetochore CCAN and CENP-C bound to DNA Deposited 2026-02-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 16 PDB declaration: 18-meric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
4DRA Crystal structure of MHF complex Deposited 2012-02-17	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–81（81 aa） Chain H 1–81（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；285 K；0.1M HEPES-NaOH, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.41 Å R-free 0.242
4DRA Crystal structure of MHF complex Deposited 2012-02-17	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 1–81（81 aa） Chain G 1–81（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；285 K；0.1M HEPES-NaOH, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.41 Å R-free 0.242
4E44 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer Deposited 2012-03-12	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–81（81 aa） Chain D 1–81（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.10 Å R-free 0.231
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–81（81 aa） Chain D 1–81（81 aa）	Not recorded	GOL GLYCEROL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain G 1–81（81 aa） Chain I 1–81（81 aa）	Not recorded	GOL GLYCEROL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4E45 Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi Anemia Associated Helicase hFANCM Deposited 2012-03-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain L 1–81（81 aa） Chain N 1–81（81 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；298 K；Tracking Code C4, 0.1M Tris pH 7.8, 0.2M LiCl, 0.1M Na2SO4, 17.5% w/v PEG3350, 10% glycerol cryo., vapor diffusion, sitting drop, temperature 298K	Resolution 2.00 Å R-free 0.245
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain M 8–81（74 aa） Chain N 8–81（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 4 PDB declaration: octameric	Chain L 8–81（74 aa） Chain U 8–81（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain V 8–81（74 aa） Chain W 8–81（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 8–81（74 aa） Chain X 8–81（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NDY Human MHF1-MHF2 DNA complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 8–81（74 aa） Chain H 8–81（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M Ammonium Phosphate, Micro-batch under oil, temperature 300K	Resolution 7.00 Å R-free 0.279
4NE1 Human MHF1 MHF2 DNA complexes Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain B 8–81（74 aa） Chain D 8–81（74 aa） Chain H 8–81（74 aa） Chain L 8–81（74 aa） Chain M 8–81（74 aa） Chain N 8–81（74 aa） Chain U 8–81（74 aa） Chain V 8–81（74 aa） Chain W 8–81（74 aa） Chain X 8–81（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M ammonium phosphate, Micro-batch under oil, temperature 300K	Resolution 6.50 Å R-free 0.295
4NE1 Human MHF1 MHF2 DNA complexes Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain Z 8–81（74 aa） Chain b 8–81（74 aa） Chain d 8–81（74 aa） Chain h 8–81（74 aa） Chain i 8–81（74 aa） Chain j 8–81（74 aa） Chain o 8–81（74 aa） Chain p 8–81（74 aa） Chain q 8–81（74 aa） Chain r 8–81（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；0.1-0.3M ammonium phosphate, Micro-batch under oil, temperature 300K	Resolution 6.50 Å R-free 0.295
4NE3 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 8–81（74 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.252
4NE5 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 8–81（74 aa） Chain F 8–81（74 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；Micro-batch under oil, temperature 300K	Resolution 2.50 Å R-free 0.264
4NE5 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 8–81（74 aa） Chain H 8–81（74 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；Micro-batch under oil, temperature 300K	Resolution 2.50 Å R-free 0.264
4NE6 Human MHF1-MHF2 complex Deposited 2013-10-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 8–81（74 aa） Chain D 8–81（74 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；300 K；Micro-batch under oil, temperature 300K	Resolution 2.10 Å R-free 0.262
7R5S Structure of the human CCAN bound to alpha satellite DNA Deposited 2022-02-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 15 PDB declaration: heptadecameric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.83 Å
7XHN Structure of human inner kinetochore CCAN-DNA complex Deposited 2022-04-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.71 Å
7XHO Structure of human inner kinetochore CCAN complex Deposited 2022-04-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
7YWX Structure of the human CCAN CENP-A alpha-satellite complex Deposited 2022-02-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 25 PDB declaration: 27-meric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
9TAW Structure of the human inner kinetochore CCAN bound to DNA Deposited 2025-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å
9TAX Structure of the human inner kinetochore CCAN bound to a mono-CENP-A nucleosome Deposited 2025-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 25 PDB declaration: 27-meric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
9TAY Structure of the human inner kinetochore CCAN bound to a di-CENP-A nucleosome Deposited 2025-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 35 PDB declaration: 37-meric	Chain X 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.50 Å

16 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CENPX_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 4–84； UniProt 1–81 Author chain K； PDBConstruct 4–84； UniProt 1–81 Author chain L； PDBConstruct 4–84； UniProt 1–81 Author chain M； PDBConstruct 4–84； UniProt 1–81 Author chain N； PDBConstruct 4–84； UniProt 1–81 Author chain O； PDBConstruct 4–84； UniProt 1–81

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4drb
Deposition date deposition_date	2012-02-17
Structure title title	The crystal structure of FANCM bound MHF complex
Keywords keywords	;DNA repair, DNA binding complex, Histone fold, DNA damage repair, DNA binding, DNA BINDING-PROTEIN BINDING complex, DNA BINDING PROTEIN-PROTEIN BINDING complex ;; DNA BINDING PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	40.46 Å
Radius of gyration Rg (electron density) rg_electron	40.16 Å
Forward intensity I(0) i0	341709000.00
Molecular weight molecular_weight	148040.0 kDa
Excluded volume excluded_volume	183720 Å³
Envelope volume envelope_volume	249240 Å³
Hydration-shell volume shell_volume	52459 Å³
Envelope diameter envelope_diameter	142.6 Å
Shell Rg shell_rg	45.26 Å
Envelope Rg envelope_rg	39.40 Å
Shape Rg shape_rg	40.17 Å
Total Rg total_rg	40.40 Å
Total atoms total_atoms	10363
Residues n_residues	1329
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	132.5 Å
Rg (real space) rg_real	40.48 Å
Rg uncertainty (real space) rg_real_error	1.45 Å
I(0) (real space) i0_real	3.4170e+08
I(0) uncertainty (real space) i0_real_error	6.3470e+06
Rg (reciprocal space) rg_reciprocal	40.46 Å
I(0) (reciprocal space) i0_reciprocal	341700000.0000
Solution quality estimate total_estimate	0.8870
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	44.1 Å
Skewness Skewness skewness	0.305
Kurtosis Kurtosis kurtosis	-0.484
Angular range angular_range	— – 0.1950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	49380000.0000
Real-space data points n_real_points	40
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.922; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.962; Smooth: 0.798

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Centromere protein S
Molecular weight formula_weight	14325.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,E,G,H
Atom count atom_count	10508

HHHHHHMEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Fanconi anemia group M protein
Molecular weight formula_weight	16845.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I

GSIFSYRDGMRQSSLKKDWFLSEEEFKLWNRLYRLRDSDEIKEITLPQVQFSSLQNEENKPAQESTTGIHQLSLSEWRLWQDHPLPTHQVDHSDRCRHFIGLMQMIEGMRHEEGECSYELEVESYLQMEDVTSTFIAPRNE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Centromere protein X
Molecular weight formula_weight	9348.5 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,L,M,N,O

GSHMEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	120

▼

7. Fold Classification (SCOP + CATH) 18 domains

CATH v4.4 (18 domains)

Domain ID domain_id	4drbA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4drbB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4drbD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4drbE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4drbG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4drbH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4drbJ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4drbJ02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4drbK01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4drbK02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4drbL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4drbL02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4drbM01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4drbM02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4drbN01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4drbN02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4drbO01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4drbO02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	111.317 Å
Unit-cell length b length_b	70.025 Å
Unit-cell length c length_c	115.751 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.41 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.634 Å
Low-resolution limit resolution_low	49.670 Å
R factor r_factor	0.2223
R_work r_work	0.2205
R_free r_free	0.2556

fit	/app/data/saxs_computation/dr/4drb/4drb.fit
pddf	/app/data/pr_computation/dr/4drb/4drb.pr.out
profile	/app/data/saxs_computation/dr/4drb/4drb.dat

The crystal structure of FANCM bound MHF complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere protein S

State in the Current Structure

Other States of the Same Protein in the Database

Fanconi anemia group M protein

State in the Current Structure

Other States of the Same Protein in the Database

Centromere protein X

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 18 domains

CATH v4.4 (18 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)