4e7v

The structure of R6 bovine insulin

Method: X-RAY DIFFRACTION D_max: 108.7 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 1； UniProt 85–105 Chain 2； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
10	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain O； UniProt 85–105 Chain P； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
11	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain Q； UniProt 85–105 Chain R； UniProt 25–54	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
12	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain S； UniProt 85–105 Chain T； UniProt 25–54	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
13	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain U； UniProt 85–105 Chain V； UniProt 25–54	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
14	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain W； UniProt 85–105 Chain X； UniProt 25–54	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
15	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 3； UniProt 85–105 Chain 4； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
16	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 5； UniProt 85–105 Chain 6； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
17	Protein homooligomer Homooligomer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 1； UniProt 85–105 Chain 2； UniProt 25–54 Chain Y； UniProt 85–105 Chain Z； UniProt 25–54	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
18	Protein homooligomer Homooligomer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 3； UniProt 85–105 Chain 4； UniProt 25–54 Chain 5； UniProt 85–105 Chain 6； UniProt 25–54	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
19	Protein homooligomer Homooligomer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain M； UniProt 85–105 Chain N； UniProt 25–54 Chain O； UniProt 85–105 Chain P； UniProt 25–54 Chain Q； UniProt 85–105 Chain R； UniProt 25–54 Chain S； UniProt 85–105 Chain T； UniProt 25–54 Chain U； UniProt 85–105 Chain V； UniProt 25–54 Chain W； UniProt 85–105 Chain X； UniProt 25–54	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
2	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 85–105 Chain B； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
20	Protein homooligomer Homooligomer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 85–105 Chain B； UniProt 25–54 Chain C； UniProt 85–105 Chain D； UniProt 25–54 Chain E； UniProt 85–105 Chain F； UniProt 25–54 Chain G； UniProt 85–105 Chain H； UniProt 25–54 Chain I； UniProt 85–105 Chain J； UniProt 25–54 Chain K； UniProt 85–105 Chain L； UniProt 25–54	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
3	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 85–105 Chain D； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 85–105 Chain F； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
5	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 85–105 Chain H； UniProt 25–54	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
6	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain I； UniProt 85–105 Chain J； UniProt 25–54	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
7	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 85–105 Chain L； UniProt 25–54	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
8	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain Y； UniProt 85–105 Chain Z； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
9	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain M； UniProt 85–105 Chain N； UniProt 25–54	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4E7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1APH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1APH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1APH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 1 DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 1 DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 3 DCE 1,2-DICHLOROETHANE × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 1 DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1HO0 NEW B-CHAIN MUTANT OF BOVINE INSULIN Deposited 2000-12-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 25–54（30 aa） Fragment：B-CHAIN	Mutation：C7S, C19S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 3.6；293 K；Ionic strength (raw mmCIF value) 0；Pressure ambient NMR sample composition 0.5 mM peptide concentration \| 70 % H2O / 30 % deuterated TFE	Resolution not provided
1PID BOVINE DESPENTAPEPTIDE INSULIN Deposited 1995-11-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–49（25 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.30 Å
1PID BOVINE DESPENTAPEPTIDE INSULIN Deposited 1995-11-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 25–49（25 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.30 Å
2A3G The structure of T6 bovine insulin Deposited 2005-06-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Fragment：insulin A chain, residues 85-105 Chain B 25–54（30 aa） Fragment：insulin B chain, residues 25-54 Chain C 85–105（21 aa） Fragment：insulin A chain, residues 85-105 Chain D 25–54（30 aa） Fragment：insulin B chain, residues 25-54	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.2；298 K；HCl, ZINC ACETATE, SODIUM CITRATE, ACETONE, pH 6.2, SLOW COOLING, temperature 298 K, pH 6.20	Resolution 2.25 Å R-free 0.219
2BN1 Insulin after a high dose x-ray burn Deposited 2005-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN, RESIDUES 85-105 Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN, RESIDUES 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions .4 M NAPO4/NA2HPO4 PH10.4, 0.001M EDTA, 30% ETHYLENE GLYCOL	Resolution 1.40 Å R-free 0.165
2BN3 Insulin before a high dose x-ray burn Deposited 2005-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN, RESIDUES 85-105 Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN, RESIDUES 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.4 M NAPO4/NA2HPO4 PH 10.4, 0.001 M EDTA,30%ETHYLENE GLYCOL	Resolution 1.40 Å R-free 0.161
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Chain B 26–54（29 aa） Chain C 85–105（21 aa） Chain D 26–54（29 aa）	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–105（21 aa） Chain B 26–54（29 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 85–105（21 aa） Chain D 26–54（29 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 26–54（29 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 26–54（29 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2ZP6 Crystal structure of Bovine Insulin (Hexameric form) Deposited 2008-06-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；15% acetone, 0.6M Ammonium formate (metal basis), 0.6M sodium citrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.56 Å R-free 0.220
2ZP6 Crystal structure of Bovine Insulin (Hexameric form) Deposited 2008-06-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；15% acetone, 0.6M Ammonium formate (metal basis), 0.6M sodium citrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.56 Å R-free 0.220
2ZP6 Crystal structure of Bovine Insulin (Hexameric form) Deposited 2008-06-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa） Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；15% acetone, 0.6M Ammonium formate (metal basis), 0.6M sodium citrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.56 Å R-free 0.220
4BS3 Bovin insulin structure determined by in situ crystal analysis and sulfur-SAD phasing at room temperature Deposited 2013-06-06	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.2；293 K；INSULIN (30 MG/ML) WAS CRYSTALLIZED AT 293K BY VAPOR DIFFUSION (SITTING DROP) IN CRYSTALQUICK X MICROPLATE USING A RESERVOIR SOLUTION CONTAINING 0.275 M NAHPO4 / NA3PO4 PH 10.2, 0.01 M NA3EDTA.	Resolution 2.30 Å R-free 0.169
4E7T The structure of T6 bovine insulin Deposited 2012-03-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；298 K；0.05M sodium citrate, 0.5mM zinc acetate, 15% acetone, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.40 Å R-free 0.229
4E7T The structure of T6 bovine insulin Deposited 2012-03-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；298 K；0.05M sodium citrate, 0.5mM zinc acetate, 15% acetone, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.40 Å R-free 0.229
4E7U The structure of T3R3 bovine insulin Deposited 2012-03-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions BATCH METHOD；pH 6.4；298 K；6.5mg/ml bovine insulin, 7mM zinc acetate, 0.05M sodium citrate, 15% acetone, 0.2M KSCN, pH 6.4, BATCH METHOD, temperature 298K	Resolution 1.30 Å R-free 0.179
4E7U The structure of T3R3 bovine insulin Deposited 2012-03-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1 SCN THIOCYANATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions BATCH METHOD；pH 6.4；298 K；6.5mg/ml bovine insulin, 7mM zinc acetate, 0.05M sodium citrate, 15% acetone, 0.2M KSCN, pH 6.4, BATCH METHOD, temperature 298K	Resolution 1.30 Å R-free 0.179
4I5Y Insulin protein crystallization via langmuir-blodgett Deposited 2012-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：UNP residues 85-105 Chain B 25–54（30 aa） Fragment：UNP residues 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.222
4I5Z Insulin protein crystallization via langmuir-blodgett Deposited 2012-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：UNP residues 85-105 Chain B 25–54（30 aa） Fragment：UNP residues 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.218
4IDW Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution and Novel Structure Refinement Strategy Deposited 2012-12-13	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	POWDER DIFFRACTION X-ray crystallization conditions Batch；pH 6；295 K；polycrystalline samples of T6 hexameric insulin (Zn2[(AB)2]3, the pH was adjusted by mixing different ratios of 0.2M solutions of sodium monobasic monohydrate phosphate and potassium phosphate., Batch, temperature 295K	Resolution 2.70 Å
4IDW Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution and Novel Structure Refinement Strategy Deposited 2012-12-13	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	POWDER DIFFRACTION X-ray crystallization conditions Batch；pH 6；295 K；polycrystalline samples of T6 hexameric insulin (Zn2[(AB)2]3, the pH was adjusted by mixing different ratios of 0.2M solutions of sodium monobasic monohydrate phosphate and potassium phosphate., Batch, temperature 295K	Resolution 2.70 Å
4IHN High Resolution Insulin by Langmuir-Blodgett Modified Hanging Drop Vapour Diffusion Deposited 2012-12-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.16 Å R-free 0.260
4M4F Radiation damage study of Cu T6-insulin - 0.01 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：Insulin A chain (UNP residues 85-105) Chain B 25–54（30 aa） Fragment：Insulin B chain (UNP residues 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.235
4M4F Radiation damage study of Cu T6-insulin - 0.01 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：Insulin A chain (UNP residues 85-105) Chain D 25–54（30 aa） Fragment：Insulin B chain (UNP residues 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.235
4M4H Radiation damage study of Cu T6-insulin - 0.06 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4H Radiation damage study of Cu T6-insulin - 0.06 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4I Radiation damage study of Cu T6-insulin - 0.12 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.202
4M4I Radiation damage study of Cu T6-insulin - 0.12 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.202
4M4J Radiation damage study of Cu T6-insulin - 0.30 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4J Radiation damage study of Cu T6-insulin - 0.30 MGy Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4L The structure of Cu T6 bovine insulin Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.204
4M4L The structure of Cu T6 bovine insulin Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.204
4M4M The structure of Ni T6 bovine insulin Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；298 K；0.05M sodium citrate, 15%(v/v) acetone, 15mM nickel(II)acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.224
4M4M The structure of Ni T6 bovine insulin Deposited 2013-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；298 K；0.05M sodium citrate, 15%(v/v) acetone, 15mM nickel(II)acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.224
5AZZ Crystal structure of seleno-insulin Deposited 2015-10-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Mutation：C7(SEC) Mutation：C7(SEC)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；Sodium chloride, ethylene imine polymer, citrate	Resolution 1.45 Å R-free 0.192
5KQV Insulin receptor ectodomain construct comprising domains L1,CR,L2, FnIII-1 and alphaCT peptide in complex with bovine insulin and FAB 83-14 (REVISED STRUCTURE) Deposited 2016-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 20 PDB declaration: eicosameric	Chain A 85–105（21 aa） Fragment：UNP Residues 85-105 Chain B 25–54（30 aa） Fragment：UNP Residues 25-54 Chain I 85–105（21 aa） Fragment：UNP Residues 85-105 Chain J 25–54（30 aa） Fragment：UNP Residues 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；9% POLYETHYLENE GLYCOL 3350, 200MM PROLINE, 100MM HEPES/NAOH, PH 7.5	Resolution 4.40 Å R-free 0.266
5MIZ MD ensemble of bovine insulin Deposited 2016-11-29	Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 2.86；293 K；Ionic strength (raw mmCIF value) 1.4；Pressure 1 NMR measurement conditions pH 2.86；308 K；Ionic strength (raw mmCIF value) 1.4；Pressure 1 NMR sample composition 1.1 mM Bovine insulin, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6KH8 Solution structure of Zn free Bovine Pancreatic Insulin in 20% acetic acid-d4 (pH 1.9) Deposited 2019-07-14	Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 1.9；298 K；Ionic strength (raw mmCIF value) 20% ACETIC ACID；Pressure 1 NMR sample composition 350 uM Bovine insulin Chain A, 350 uM Bovine Insulin chain B, 20% acetic acid-D4 \| 20% acetic acid-D4	Resolution not provided
6KH9 Solution structure of bovine insulin amyloid intermediate-1 Deposited 2019-07-14	Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 1.9；298 K；Ionic strength (raw mmCIF value) 20% Acetic acid-d4；Pressure ambient NMR sample composition 350 uM Bovine insulin, 20% acetic acid-d4 \| 20% acetic acid-d4	Resolution not provided
6KHA Solution structure of bovine insulin amyloid intermediate-2 Deposited 2019-07-14	Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 1.9；298 K；Ionic strength (raw mmCIF value) 20% Acetic acid-d4；Pressure AMBIENT NMR sample composition 350 uM NONE BOVINE INSULIN, 20% ACETIC ACID D4 \| 20% ACETIC ACID D4	Resolution not provided
6OR0 Crystal structure of Insulin from Non-merohedrally twinned crystals Deposited 2019-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–53（29 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.2 M Na2HPO4/Na3PO4, pH 10.0 and 0.01 M Na EDTA	Resolution 1.55 Å R-free 0.215
6Q8Q Bovine Insulin under 2 kbar of argon Deposited 2018-12-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	AR ARGON × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；PROTEIN DROP: 10 MG/ML. RESERVOIR: 1.2 M TMAO + 0.1 M SODIUM MALATE, PH 5.5	Resolution 2.00 Å R-free 0.199
6QQ7 Bovine insulin at ambient pressure Deposited 2019-02-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 M Na2HPO4, 0.1 M Na2EDTA	Resolution 1.65 Å R-free 0.190
6QQG High pressure structure of bovine insulin (60 MPa) Deposited 2019-02-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 M Na3EDTA, 0.1 M Na2HPO4	Resolution 2.15 Å R-free 0.176
6QRH High pressure structure of bovine insulin (100 MPa) Deposited 2019-02-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 M Na3 EDTA, 0.1 M Na2HEDTA	Resolution 2.15 Å R-free 0.232
6QRK High pressure structure of bovine insulin (200 MPa) Deposited 2019-02-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 Na3EDTA, 0.1 MNa2HEDTA	Resolution 2.10 Å R-free 0.248
6ZHB 3D electron diffraction structure of bovine insulin Deposited 2020-06-22	Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa） Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON CRYSTALLOGRAPHY cryo-EM buffer pH 6.5；MES buffer, 50 mM cryo-EM vitrification conditions Cryogen ETHANE；Manual plunger	Resolution 3.25 Å R-free 0.319
6ZI8 X-ray diffraction structure of bovine insulin at 2.3 A resolution Deposited 2020-06-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–105（105 aa） Chain B 1–105（105 aa） Chain C 1–105（105 aa） Chain D 1–105（105 aa）	Not recorded	ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；pH 6.5；293 K；50mM MES pH 6.5, 10mM ZnCl2, 10mM NaCl in double-distilled water	Resolution 2.30 Å R-free 0.238
7ELJ Prion Derived Tetrapeptide Stabilizes Thermolabile Insulin via Conformational Trapping Deposited 2021-04-11	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 2.6；298 K；Ionic strength (raw mmCIF value) 1；Pressure 1 NMR sample composition 1 mM Proton Bovine Insulin, 1 mM Proton-15N, 13C Peptide, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

39 other PDB entries and 67 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	INS_BOVIN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–21； UniProt 85–105 Author chain 3； PDBConstruct 1–21； UniProt 85–105 Author chain 5； PDBConstruct 1–21； UniProt 85–105 Author chain A； PDBConstruct 1–21； UniProt 85–105 Author chain C； PDBConstruct 1–21； UniProt 85–105 Author chain E； PDBConstruct 1–21； UniProt 85–105 Author chain G； PDBConstruct 1–21； UniProt 85–105 Author chain I； PDBConstruct 1–21； UniProt 85–105 Author chain K； PDBConstruct 1–21； UniProt 85–105 Author chain M； PDBConstruct 1–21； UniProt 85–105 Author chain O； PDBConstruct 1–21； UniProt 85–105 Author chain Q； PDBConstruct 1–21； UniProt 85–105 Author chain S； PDBConstruct 1–21； UniProt 85–105 Author chain U； PDBConstruct 1–21； UniProt 85–105 Author chain W； PDBConstruct 1–21； UniProt 85–105 Author chain Y； PDBConstruct 1–21； UniProt 85–105 Author chain 2； PDBConstruct 1–30； UniProt 25–54 Author chain 4； PDBConstruct 1–30； UniProt 25–54 Author chain 6； PDBConstruct 1–30； UniProt 25–54 Author chain B； PDBConstruct 1–30； UniProt 25–54 Author chain D； PDBConstruct 1–30； UniProt 25–54 Author chain F； PDBConstruct 1–30； UniProt 25–54 Author chain H； PDBConstruct 1–30； UniProt 25–54 Author chain J； PDBConstruct 1–30； UniProt 25–54 Author chain L； PDBConstruct 1–30； UniProt 25–54 Author chain N； PDBConstruct 1–30； UniProt 25–54 Author chain P； PDBConstruct 1–30； UniProt 25–54 Author chain R； PDBConstruct 1–30； UniProt 25–54 Author chain T； PDBConstruct 1–30； UniProt 25–54 Author chain V； PDBConstruct 1–30； UniProt 25–54 Author chain X； PDBConstruct 1–30； UniProt 25–54 Author chain Z； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4e7v
Deposition date deposition_date	2012-03-19
Structure title title	The structure of R6 bovine insulin
Keywords keywords	Zinc binding, HORMONE; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.19 Å
Radius of gyration Rg (electron density) rg_electron	32.53 Å
Forward intensity I(0) i0	135659000.00
Molecular weight molecular_weight	90862.0 kDa
Excluded volume excluded_volume	112400 Å³
Envelope volume envelope_volume	147860 Å³
Hydration-shell volume shell_volume	38462 Å³
Envelope diameter envelope_diameter	113.2 Å
Shell Rg shell_rg	38.61 Å
Envelope Rg envelope_rg	32.24 Å
Shape Rg shape_rg	32.51 Å
Total Rg total_rg	33.08 Å
Total atoms total_atoms	6304
Residues n_residues	784
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	108.7 Å
Rg (real space) rg_real	33.16 Å
Rg uncertainty (real space) rg_real_error	1.01 Å
I(0) (real space) i0_real	1.3570e+08
I(0) uncertainty (real space) i0_real_error	2.2200e+06
Rg (reciprocal space) rg_reciprocal	33.17 Å
I(0) (reciprocal space) i0_reciprocal	135700000.0000
Solution quality estimate total_estimate	0.8905
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	36.2 Å
Skewness Skewness skewness	0.255
Kurtosis Kurtosis kurtosis	-0.497
Angular range angular_range	— – 0.2400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	29000000.0000
Real-space data points n_real_points	49
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.904; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.978; Smooth: 0.883

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Insulin A chain
Molecular weight formula_weight	2339.6 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O,Q,S,U,W,Y,1,3,5
Atom count atom_count	6816

GIVEQCCASVCSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	Insulin B chain
Molecular weight formula_weight	3403.9 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P,R,T,V,X,Z,2,4,6

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Entity 3 Entity 3 non-polymer

Description description	M-CRESOL
Molecular weight formula_weight	108.1 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	454

▶

8. Citations (1)

▶

Unit-cell length a length_a	156.240 Å
Unit-cell length b length_b	156.240 Å
Unit-cell length c length_c	78.880 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	144

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	28.880 Å
R factor r_factor	0.2119
R_work r_work	0.2088
R_free r_free	0.2717

fit	/app/data/saxs_computation/e7/4e7v/4e7v.fit
pddf	/app/data/pr_computation/e7/4e7v/4e7v.pr.out
profile	/app/data/saxs_computation/e7/4e7v/4e7v.dat

The structure of R6 bovine insulin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)