SAXSdb — 4eaj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;5'-AMP-activated protein kinase catalytic subunit alpha-1 ;

Rattus norvegicus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 405–479 Chain A； UniProt 540–559	Not recorded	;5'-AMP-activated protein kinase subunit beta-2 ; × 1 （O43741） ;5'-AMP-activated protein kinase subunit gamma-1 ; × 1 （P80385） ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.26；298 K；MES pH 6.26, 16% IPP, 1% 1,4-butanediol, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.61 Å R-free 0.258

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4EAJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2V8Q Crystal structure of the regulatory fragment of mammalian AMPK in complexes with AMP Deposited 2007-08-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 396–548（153 aa） Fragment：RESIDUES 396-548	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.237
2V92 Crystal structure of the regulatory fragment of mammalian AMPK in complexes with ATP-AMP Deposited 2007-08-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 396–548（153 aa） Fragment：RESIDUES 396-548	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.259
2V9J Crystal structure of the regulatory fragment of mammalian AMPK in complexes with Mg.ATP-AMP Deposited 2007-08-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 396–548（153 aa） Fragment：RESIDUES 396-548	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.53 Å R-free 0.266
2Y8L Structure of the regulatory fragment of mammalian aMPK in complex with two ADP Deposited 2011-02-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 407–555（149 aa） Fragment：RESIDUES 407-555	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.253
2Y8Q Structure of the regulatory fragment of mammalian AMPK in complex with one ADP Deposited 2011-02-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 407–555（149 aa） Fragment：RESIDUES 406-555	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.275
2YA3 STRUCTURE OF THE REGULATORY FRAGMENT OF MAMMALIAN AMPK IN COMPLEX WITH COUMARIN ADP Deposited 2011-02-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 407–555（149 aa） Fragment：RESIDUES 407-555	Not recorded	J7V 3'-(7-diethylaminocoumarin-3-carbonylamino)-3'-deoxy-ADP × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.51 Å R-free 0.263
4CFH Structure of an active form of mammalian AMPK Deposited 2013-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 13–481（469 aa） Fragment：RESIDUES 13-481 Chain C 535–559（25 aa） Fragment：RESIDUES 535-559	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；CRYSTALS WERE GROWN BY THE HANGING DROP METHOD WITH RESERVOIR SOLUTION CONTAINING 8% ISOPROPANOL AND 5% MPD AS PRECIPITANT IN 0.1M TRIS AT PH 7.5 AT 18 DEGREES.	Resolution 3.24 Å R-free 0.268
4EAI Co-crystal structure of an AMPK core with AMP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 405–479（75 aa） Chain A 540–559（20 aa）	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.26；298 K；MES, 16% IPP, 1% 1,4-butanediol, pH 6.26, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.29 Å R-free 0.252
4EAK Co-crystal structure of an AMPK core with ATP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 405–479（75 aa） Chain A 540–559（20 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；298 K；0.1M MES pH 5.9, 18% IPP, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.50 Å R-free 0.254
4EAL Co-crystal of AMPK core with ATP soaked with AMP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 405–479（75 aa） Chain A 540–559（20 aa）	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；298 K；0.1M MES pH5.9, 18% IPP, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.51 Å R-free 0.277
4F2L Structure of a regulatory domain of AMPK Deposited 2012-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 295–347（53 aa） Fragment：regulatory domain, UNP RESIDUES 295-347	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；0.1M HEPES, 0.3M Magnesium sulfate, 36% isopropanol (v/v), pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K	Resolution 1.50 Å R-free 0.212
4F2L Structure of a regulatory domain of AMPK Deposited 2012-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 295–347（53 aa） Fragment：regulatory domain, UNP RESIDUES 295-347	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；0.1M HEPES, 0.3M Magnesium sulfate, 36% isopropanol (v/v), pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K	Resolution 1.50 Å R-free 0.212
4QFG Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator Deposited 2014-05-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–480（470 aa） Fragment：AMPK alpha1 Chain A 536–559（24 aa） Fragment：AMPK alpha1	Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 CL CHLORIDE ION × 3 SO4 SULFATE ION × 3 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene Glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.46 Å R-free 0.267
4QFG Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator Deposited 2014-05-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–480（470 aa） Fragment：AMPK alpha1 Chain A 536–559（24 aa） Fragment：AMPK alpha1	Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 CL CHLORIDE ION × 6 SO4 SULFATE ION × 6 AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene Glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.46 Å R-free 0.267
4QFR Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–480（470 aa） Fragment：AMPK alpha 1 Chain A 536–559（24 aa） Fragment：AMPK alpha 1	Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 CL CHLORIDE ION × 5 32J 2-chloro-4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 1 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.34 Å R-free 0.249
4QFR Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–480（470 aa） Fragment：AMPK alpha 1 Chain A 536–559（24 aa） Fragment：AMPK alpha 1	Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 CL CHLORIDE ION × 10 32J 2-chloro-4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 2 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.34 Å R-free 0.249
4QFR Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–480（470 aa） Fragment：AMPK alpha 1 Chain A 536–559（24 aa） Fragment：AMPK alpha 1	Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 CL CHLORIDE ION × 10 32J 2-chloro-4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 2 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.34 Å R-free 0.249
4QFS Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–479（469 aa） Fragment：AMPK alpha 1 Chain A 536–559（24 aa） Fragment：AMPK alpha 1	Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 32H 2-bromo-3-(4-bromophenyl)-4-hydroxy-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 1 CL CHLORIDE ION × 5 AMP ADENOSINE MONOPHOSPHATE × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.55 Å R-free 0.269
4QFS Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–479（469 aa） Fragment：AMPK alpha 1 Chain A 536–559（24 aa） Fragment：AMPK alpha 1	Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Deletion 470-524; replaced by ASGGPGGS Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 32H 2-bromo-3-(4-bromophenyl)-4-hydroxy-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 2 CL CHLORIDE ION × 10 AMP ADENOSINE MONOPHOSPHATE × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.55 Å R-free 0.269
5KQ5 AMPK bound to allosteric activator Deposited 2016-07-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–559（549 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 6VT 6-chloranyl-5-[4-(1-oxidanylcyclobutyl)phenyl]-1~{H}-indole-3-carboxylic acid × 1 CL CHLORIDE ION × 4 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；~750 mM Ammonium Acetate, 500 mM Lithium Sulfate, 100 mM trisodium citrate, 1% ethylene glycol	Resolution 3.41 Å R-free 0.259
5T5T AMPK bound to allosteric activator Deposited 2016-08-31	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–559（549 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 CL CHLORIDE ION × 3 SO4 SULFATE ION × 2 75O 6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carboxylic acid × 1 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；100 mM trisodium citrate, 500 mM ammonium sulfate, 900 mM lithium sulfate, and 4% glycerol	Resolution 3.46 Å R-free 0.231
5T5T AMPK bound to allosteric activator Deposited 2016-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–559（549 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 CL CHLORIDE ION × 6 SO4 SULFATE ION × 4 75O 6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carboxylic acid × 2 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；100 mM trisodium citrate, 500 mM ammonium sulfate, 900 mM lithium sulfate, and 4% glycerol	Resolution 3.46 Å R-free 0.231
5UFU Structure of AMPK bound to activator Deposited 2017-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–480（470 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 85V 1,4:3,6-dianhydro-2-O-(6-chloro-5-{4-[1-(hydroxymethyl)cyclopropyl]phenyl}-1H-benzimidazol-2-yl)-D-mannitol × 1 CL CHLORIDE ION × 3 SO4 SULFATE ION × 2 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 mM ammonium sulfate 500 mM lithium sulfate 100 mM trisodium citrate 1% ethylene glycol	Resolution 3.45 Å R-free 0.238
5UFU Structure of AMPK bound to activator Deposited 2017-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–480（470 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 85V 1,4:3,6-dianhydro-2-O-(6-chloro-5-{4-[1-(hydroxymethyl)cyclopropyl]phenyl}-1H-benzimidazol-2-yl)-D-mannitol × 2 CL CHLORIDE ION × 6 SO4 SULFATE ION × 4 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 mM ammonium sulfate 500 mM lithium sulfate 100 mM trisodium citrate 1% ethylene glycol	Resolution 3.45 Å R-free 0.238
6E4T Structure of AMPK bound to activator Deposited 2018-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–480（470 aa） Chain A 536–559（24 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	HTV 1-O-{6-chloro-5-[4-(1-hydroxycyclobutyl)phenyl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 1 STU STAUROSPORINE × 1 CL CHLORIDE ION × 5 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.40 Å R-free 0.245
6E4T Structure of AMPK bound to activator Deposited 2018-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–480（470 aa） Chain A 536–559（24 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	HTV 1-O-{6-chloro-5-[4-(1-hydroxycyclobutyl)phenyl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 2 STU STAUROSPORINE × 2 CL CHLORIDE ION × 10 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.40 Å R-free 0.245
6E4U Structure of AMPK bound to activator Deposited 2018-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–480（470 aa） Chain A 536–559（24 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 HU7 1-O-{6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 1 CL CHLORIDE ION × 4 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.27 Å R-free 0.231
6E4U Structure of AMPK bound to activator Deposited 2018-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–480（470 aa） Chain A 536–559（24 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 HU7 1-O-{6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 2 CL CHLORIDE ION × 8 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.27 Å R-free 0.231
6E4W Structure of AMPK bound to activator Deposited 2018-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 11–480（470 aa） Chain A 536–559（24 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 HUG 1-O-(4,6-difluoro-5-{4-[(2S)-oxan-2-yl]phenyl}-1H-indole-3-carbonyl)-beta-D-glucopyranuronic acid × 1 CL CHLORIDE ION × 3 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.35 Å R-free 0.244
6E4W Structure of AMPK bound to activator Deposited 2018-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 11–480（470 aa） Chain A 536–559（24 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 2 HUG 1-O-(4,6-difluoro-5-{4-[(2S)-oxan-2-yl]phenyl}-1H-indole-3-carbonyl)-beta-D-glucopyranuronic acid × 2 CL CHLORIDE ION × 6 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.35 Å R-free 0.244

20 other PDB entries and 30 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AAPK1_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–80； UniProt 405–479 Author chain A； PDBConstruct 87–106； UniProt 540–559

;5'-AMP-activated protein kinase subunit beta-2 ;

Homo sapiens

UniProt O43741

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 189–272	Fragment：UNP residues 189-272	;5'-AMP-activated protein kinase catalytic subunit alpha-1 ; × 1 （P54645） ;5'-AMP-activated protein kinase subunit gamma-1 ; × 1 （P80385） ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.26；298 K；MES pH 6.26, 16% IPP, 1% 1,4-butanediol, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.61 Å R-free 0.258

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4EAJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2F15 Glycogen-Binding Domain Of The Amp-Activated Protein Kinase beta2 Subunit Deposited 2005-11-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 69–163（95 aa） Fragment：Glycogen-Binding Domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；27% MPD, 0.1 M Hepes, pH 7.5, 0.2 M Ammonium Sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.296
2V8Q Crystal structure of the regulatory fragment of mammalian AMPK in complexes with AMP Deposited 2007-08-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 187–272（86 aa） Fragment：RESIDUES 187-272	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.237
2V92 Crystal structure of the regulatory fragment of mammalian AMPK in complexes with ATP-AMP Deposited 2007-08-20	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 187–272（86 aa） Fragment：RESIDUES 187-272	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.259
2V9J Crystal structure of the regulatory fragment of mammalian AMPK in complexes with Mg.ATP-AMP Deposited 2007-08-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 187–272（86 aa） Fragment：RESIDUES 187-272	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.53 Å R-free 0.266
2Y8L Structure of the regulatory fragment of mammalian aMPK in complex with two ADP Deposited 2011-02-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 187–272（86 aa） Fragment：RESIDUES 187-272	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.253
2Y8Q Structure of the regulatory fragment of mammalian AMPK in complex with one ADP Deposited 2011-02-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 187–272（86 aa） Fragment：RESIDUES 187-272	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.275
2YA3 STRUCTURE OF THE REGULATORY FRAGMENT OF MAMMALIAN AMPK IN COMPLEX WITH COUMARIN ADP Deposited 2011-02-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 187–272（86 aa） Fragment：RESIDUES 187-272	Not recorded	J7V 3'-(7-diethylaminocoumarin-3-carbonylamino)-3'-deoxy-ADP × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.51 Å R-free 0.263
4CFH Structure of an active form of mammalian AMPK Deposited 2013-11-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 187–272（86 aa） Fragment：RESIDUES 187-272	Not recorded	STU STAUROSPORINE × 1 AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；CRYSTALS WERE GROWN BY THE HANGING DROP METHOD WITH RESERVOIR SOLUTION CONTAINING 8% ISOPROPANOL AND 5% MPD AS PRECIPITANT IN 0.1M TRIS AT PH 7.5 AT 18 DEGREES.	Resolution 3.24 Å R-free 0.268
4EAI Co-crystal structure of an AMPK core with AMP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 189–272（84 aa） Fragment：UNP residues 189-272	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.26；298 K；MES, 16% IPP, 1% 1,4-butanediol, pH 6.26, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.29 Å R-free 0.252
4RER Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin Deposited 2014-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 76–272（197 aa） Fragment：Human AMPK beta2 subunit [A76-I272]	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；293 K；12% PEG 4000,0.1 M HEPES, pH7.8, 10% 2-propanol (v/v) and 0.19 mM 7-cyclohexyl-1-heptyl-D-maltoside, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 4.05 Å R-free 0.260
4REW Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex Deposited 2014-09-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 76–272（197 aa） Fragment：Human AMPK beta2 subunit [A76-I272]	Not recorded	STU STAUROSPORINE × 1 AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；293 K；0.1 M N-acetamido-iminodiacetic acid, pH 6.8, 9% 2-methyl-2,4-pentanediol, and 11.5 mM C-HEGA, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 4.58 Å R-free 0.259
6B2E Structure of full length human AMPK (a2b2g1) in complex with a small molecule activator SC4. Deposited 2017-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–272（272 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1 CG7 5-{[6-chloro-5-(2'-hydroxy[1,1'-biphenyl]-4-yl)-1H-imidazo[4,5-b]pyridin-2-yl]oxy}-2-methylbenzoic acid × 1 AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；6-8% PEG 3350, 0.1 M MgCl2, 0.001% cocamidopropyl betaine and 0.1 M imidazole	Resolution 3.80 Å R-free 0.277
7JHG Cryo-EM structure of ATP-bound fully inactive AMPK in complex with Dorsomorphin (Compound C) and Fab-nanobody Deposited 2020-07-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 75–272（198 aa）	Not recorded	TAK 6-[4-(2-piperidin-1-ylethoxy)phenyl]-3-pyridin-4-ylpyrazolo[1,5-a]pyrimidine × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AMP ADENOSINE MONOPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
7JHH Cryo-EM structure of ATP-bound fully inactive AMPK in complex with Fab and nanobody Deposited 2020-07-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 75–272（198 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AMP ADENOSINE MONOPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.92 Å
7JIJ ATP-bound AMP-activated protein kinase Deposited 2020-07-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 76–272（197 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 AMP ADENOSINE MONOPHOSPHATE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.2 M tri-lithium citrate,10% w/v PEG3350, pH7.5,0.01 M barium chloride	Resolution 5.50 Å R-free 0.323
7M74 ATP-bound AMP-activated protein kinase Deposited 2021-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 76–272（197 aa）	Not recorded	TAK 6-[4-(2-piperidin-1-ylethoxy)phenyl]-3-pyridin-4-ylpyrazolo[1,5-a]pyrimidine × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AMP ADENOSINE MONOPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.93 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AAKB2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–85； UniProt 189–272

;5'-AMP-activated protein kinase subunit gamma-1 ;

Rattus norvegicus

UniProt P80385

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 1–330	Not recorded	;5'-AMP-activated protein kinase catalytic subunit alpha-1 ; × 1 （P54645） ;5'-AMP-activated protein kinase subunit beta-2 ; × 1 （O43741） ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.26；298 K；MES pH 6.26, 16% IPP, 1% 1,4-butanediol, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.61 Å R-free 0.258

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4EAJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2V8Q Crystal structure of the regulatory fragment of mammalian AMPK in complexes with AMP Deposited 2007-08-13	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–330（330 aa）	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.237
2V92 Crystal structure of the regulatory fragment of mammalian AMPK in complexes with ATP-AMP Deposited 2007-08-20	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–330（330 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.259
2V9J Crystal structure of the regulatory fragment of mammalian AMPK in complexes with Mg.ATP-AMP Deposited 2007-08-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–330（330 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.53 Å R-free 0.266
2Y8L Structure of the regulatory fragment of mammalian aMPK in complex with two ADP Deposited 2011-02-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–330（330 aa） Fragment：RESIDUES 1-330	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.253
2Y8Q Structure of the regulatory fragment of mammalian AMPK in complex with one ADP Deposited 2011-02-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–330（330 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.275
2YA3 STRUCTURE OF THE REGULATORY FRAGMENT OF MAMMALIAN AMPK IN COMPLEX WITH COUMARIN ADP Deposited 2011-02-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–330（330 aa） Fragment：RESIDUES 1-330	Not recorded	J7V 3'-(7-diethylaminocoumarin-3-carbonylamino)-3'-deoxy-ADP × 2 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.51 Å R-free 0.263
4CFH Structure of an active form of mammalian AMPK Deposited 2013-11-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 1 AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；CRYSTALS WERE GROWN BY THE HANGING DROP METHOD WITH RESERVOIR SOLUTION CONTAINING 8% ISOPROPANOL AND 5% MPD AS PRECIPITANT IN 0.1M TRIS AT PH 7.5 AT 18 DEGREES.	Resolution 3.24 Å R-free 0.268
4EAG Co-crystal structure of an chimeric AMPK core with ATP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.02；298 K；MES, 12% Methanol, 2% 1,4-butanodiol, pH 6.02 , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.252
4EAI Co-crystal structure of an AMPK core with AMP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.26；298 K；MES, 16% IPP, 1% 1,4-butanediol, pH 6.26, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.29 Å R-free 0.252
4EAK Co-crystal structure of an AMPK core with ATP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；298 K；0.1M MES pH 5.9, 18% IPP, VAPOR DIFFUSION, HANGING DROP, temperature 298 K	Resolution 2.50 Å R-free 0.254
4EAL Co-crystal of AMPK core with ATP soaked with AMP Deposited 2012-03-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；298 K；0.1M MES pH5.9, 18% IPP, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.51 Å R-free 0.277
4QFG Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator Deposited 2014-05-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa） Fragment：AMPK gamma1	Not recorded	STU STAUROSPORINE × 1 CL CHLORIDE ION × 3 SO4 SULFATE ION × 3 AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene Glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.46 Å R-free 0.267
4QFG Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator Deposited 2014-05-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa） Fragment：AMPK gamma1	Not recorded	STU STAUROSPORINE × 2 CL CHLORIDE ION × 6 SO4 SULFATE ION × 6 AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene Glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.46 Å R-free 0.267
4QFR Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa） Fragment：AMPK gamma 1	Not recorded	STU STAUROSPORINE × 1 CL CHLORIDE ION × 5 32J 2-chloro-4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 1 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.34 Å R-free 0.249
4QFR Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa） Fragment：AMPK gamma 1	Not recorded	STU STAUROSPORINE × 2 CL CHLORIDE ION × 10 32J 2-chloro-4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 2 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.34 Å R-free 0.249
4QFR Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa） Fragment：AMPK gamma 1	Not recorded	STU STAUROSPORINE × 2 CL CHLORIDE ION × 10 32J 2-chloro-4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 2 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 3.34 Å R-free 0.249
4QFS Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa） Fragment：AMPK gamma 1	Not recorded	STU STAUROSPORINE × 1 32H 2-bromo-3-(4-bromophenyl)-4-hydroxy-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 1 CL CHLORIDE ION × 5 AMP ADENOSINE MONOPHOSPHATE × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.55 Å R-free 0.269
4QFS Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor Deposited 2014-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa） Fragment：AMPK gamma 1	Not recorded	STU STAUROSPORINE × 2 32H 2-bromo-3-(4-bromophenyl)-4-hydroxy-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile × 2 CL CHLORIDE ION × 10 AMP ADENOSINE MONOPHOSPHATE × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；750 mM Ammonium Sulfate, 500 mM Lithium Sulfate, 100 mM tri-Sodium Citrate, 1% Ethylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.55 Å R-free 0.269
5KQ5 AMPK bound to allosteric activator Deposited 2016-07-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 1 6VT 6-chloranyl-5-[4-(1-oxidanylcyclobutyl)phenyl]-1~{H}-indole-3-carboxylic acid × 1 CL CHLORIDE ION × 4 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；~750 mM Ammonium Acetate, 500 mM Lithium Sulfate, 100 mM trisodium citrate, 1% ethylene glycol	Resolution 3.41 Å R-free 0.259
5T5T AMPK bound to allosteric activator Deposited 2016-08-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 1 CL CHLORIDE ION × 3 SO4 SULFATE ION × 2 75O 6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carboxylic acid × 1 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；100 mM trisodium citrate, 500 mM ammonium sulfate, 900 mM lithium sulfate, and 4% glycerol	Resolution 3.46 Å R-free 0.231
5T5T AMPK bound to allosteric activator Deposited 2016-08-31	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 2 CL CHLORIDE ION × 6 SO4 SULFATE ION × 4 75O 6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carboxylic acid × 2 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；100 mM trisodium citrate, 500 mM ammonium sulfate, 900 mM lithium sulfate, and 4% glycerol	Resolution 3.46 Å R-free 0.231
5UFU Structure of AMPK bound to activator Deposited 2017-01-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 1 85V 1,4:3,6-dianhydro-2-O-(6-chloro-5-{4-[1-(hydroxymethyl)cyclopropyl]phenyl}-1H-benzimidazol-2-yl)-D-mannitol × 1 CL CHLORIDE ION × 3 SO4 SULFATE ION × 2 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 mM ammonium sulfate 500 mM lithium sulfate 100 mM trisodium citrate 1% ethylene glycol	Resolution 3.45 Å R-free 0.238
5UFU Structure of AMPK bound to activator Deposited 2017-01-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 2 85V 1,4:3,6-dianhydro-2-O-(6-chloro-5-{4-[1-(hydroxymethyl)cyclopropyl]phenyl}-1H-benzimidazol-2-yl)-D-mannitol × 2 CL CHLORIDE ION × 6 SO4 SULFATE ION × 4 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 mM ammonium sulfate 500 mM lithium sulfate 100 mM trisodium citrate 1% ethylene glycol	Resolution 3.45 Å R-free 0.238
6E4T Structure of AMPK bound to activator Deposited 2018-07-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	HTV 1-O-{6-chloro-5-[4-(1-hydroxycyclobutyl)phenyl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 1 STU STAUROSPORINE × 1 CL CHLORIDE ION × 5 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.40 Å R-free 0.245
6E4T Structure of AMPK bound to activator Deposited 2018-07-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa）	Not recorded	HTV 1-O-{6-chloro-5-[4-(1-hydroxycyclobutyl)phenyl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 2 STU STAUROSPORINE × 2 CL CHLORIDE ION × 10 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.40 Å R-free 0.245
6E4U Structure of AMPK bound to activator Deposited 2018-07-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 1 HU7 1-O-{6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 1 CL CHLORIDE ION × 4 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.27 Å R-free 0.231
6E4U Structure of AMPK bound to activator Deposited 2018-07-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 2 HU7 1-O-{6-chloro-5-[6-(dimethylamino)-2-methoxypyridin-3-yl]-1H-indole-3-carbonyl}-beta-D-glucopyranuronic acid × 2 CL CHLORIDE ION × 8 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.27 Å R-free 0.231
6E4W Structure of AMPK bound to activator Deposited 2018-07-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 1 HUG 1-O-(4,6-difluoro-5-{4-[(2S)-oxan-2-yl]phenyl}-1H-indole-3-carbonyl)-beta-D-glucopyranuronic acid × 1 CL CHLORIDE ION × 3 AMP ADENOSINE MONOPHOSPHATE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.35 Å R-free 0.244
6E4W Structure of AMPK bound to activator Deposited 2018-07-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–330（330 aa）	Not recorded	STU STAUROSPORINE × 2 HUG 1-O-(4,6-difluoro-5-{4-[(2S)-oxan-2-yl]phenyl}-1H-indole-3-carbonyl)-beta-D-glucopyranuronic acid × 2 CL CHLORIDE ION × 6 AMP ADENOSINE MONOPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；750 MM AMMONIUM SULFATE, 500 MM LITHIUM SULFATE, 100 MM TRISODIUM CITRATE, 1% ETHYLENE GLYCOL	Resolution 3.35 Å R-free 0.244

20 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AAKG1_RAT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–330； UniProt 1–330

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4eaj
Deposition date deposition_date	2012-03-22
Structure title title	Co-crystal of AMPK core with AMP soaked with ATP
Keywords keywords	AMPK, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.86 Å
Radius of gyration Rg (electron density) rg_electron	25.18 Å
Forward intensity I(0) i0	41563800.00
Molecular weight molecular_weight	51608.0 kDa
Excluded volume excluded_volume	65402 Å³
Envelope volume envelope_volume	79196 Å³
Hydration-shell volume shell_volume	26934 Å³
Envelope diameter envelope_diameter	89.8 Å
Shell Rg shell_rg	31.87 Å
Envelope Rg envelope_rg	25.31 Å
Shape Rg shape_rg	25.19 Å
Total Rg total_rg	25.93 Å
Total atoms total_atoms	3629
Residues n_residues	440
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	85.9 Å
Rg (real space) rg_real	25.93 Å
Rg uncertainty (real space) rg_real_error	0.67 Å
I(0) (real space) i0_real	4.1560e+07
I(0) uncertainty (real space) i0_real_error	6.2280e+05
Rg (reciprocal space) rg_reciprocal	25.91 Å
I(0) (reciprocal space) i0_reciprocal	41560000.0000
Solution quality estimate total_estimate	0.8813
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	26.8 Å
Skewness Skewness skewness	0.441
Kurtosis Kurtosis kurtosis	-0.288
Angular range angular_range	— – 0.3050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	13230000.0000
Real-space data points n_real_points	62
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.847; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.952; Smooth: 0.960

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	;5'-AMP-activated protein kinase catalytic subunit alpha-1 ;
Molecular weight formula_weight	12097.9 kDa
EC 编号 ec_number	2.7.11.1,2.7.11.27,2.7.11.31,2.7.11.26
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3683

GPHMGAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDGGGGGGGSHTIEFFEMCANLIKILAQ

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	Rat
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;5'-AMP-activated protein kinase subunit beta-2 ;
Molecular weight formula_weight	9886.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	;5'-AMP-activated protein kinase subunit gamma-1 ;
Molecular weight formula_weight	37434.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	Rat
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	ADENOSINE MONOPHOSPHATE
Molecular weight formula_weight	347.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	54

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	4eajA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	80 — Kinase associated domain 1, KA1

▶

8. Citations (1)

▶

Unit-cell length a length_a	97.104 Å
Unit-cell length b length_b	116.006 Å
Unit-cell length c length_c	48.840 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.609 Å
Low-resolution limit resolution_low	29.609 Å
R factor r_factor	0.2043
R_work r_work	0.2015
R_free r_free	0.2580

fit	/app/data/saxs_computation/ea/4eaj/4eaj.fit
pddf	/app/data/pr_computation/ea/4eaj/4eaj.pr.out
profile	/app/data/saxs_computation/ea/4eaj/4eaj.dat

Co-crystal of AMPK core with AMP soaked with ATP

1. Protein Identity and Related Structures Protein Identity & Related Structures

;5'-AMP-activated protein kinase catalytic subunit alpha-1 ;

State in the Current Structure

Other States of the Same Protein in the Database

;5'-AMP-activated protein kinase subunit beta-2 ;

State in the Current Structure

Other States of the Same Protein in the Database

;5'-AMP-activated protein kinase subunit gamma-1 ;

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)