4fnk

Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin

Method: X-RAY DIFFRACTION D_max: 139.1 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemagglutinin HA1 chain

Influenza A virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Homooligomer Protein × 6 其他Polymer 9 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 27–345 Chain B； UniProt 346–519 Chain C； UniProt 27–345 Chain D； UniProt 346–519 Chain E； UniProt 27–345 Chain F； UniProt 346–519	Fragment：UNP residues 27-345 Fragment：UNP residues 346-519	;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7 SO4 SULFATE ION × 6 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；2.0 M ammonium sulfate, 100 mM sodium cacodylate, pH 6.5, 200 mM sodium chloride, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.90 Å R-free 0.189

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4FNK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3SDY Crystal Structure of Broadly Neutralizing Antibody CR8020 Bound to the Influenza A H3 Hemagglutinin Deposited 2011-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 27–345（319 aa） Fragment：UNP residues 27-345 Chain B 346–521（176 aa） Fragment：UNP residues 346-521	Not recorded	SO4 SULFATE ION × 30	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；298 K；1.8M ammonium sulfate, 100mM sodium acetate 5.4, and 50mM NaCl, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.85 Å R-free 0.235
4FP8 Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2012-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 59–325（267 aa） Fragment：UNP residues 59-325	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；277 K；10% w/v PEG3000, 200 mM zinc acetate, 100 mM sodium acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.95 Å R-free 0.241
4FP8 Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2012-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 59–325（267 aa） Fragment：UNP residues 59-325	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；277 K；10% w/v PEG3000, 200 mM zinc acetate, 100 mM sodium acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.95 Å R-free 0.241
4FP8 Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2012-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 59–325（267 aa） Fragment：UNP residues 59-325	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；277 K；10% w/v PEG3000, 200 mM zinc acetate, 100 mM sodium acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.95 Å R-free 0.241
4FP8 Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2012-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 59–325（267 aa） Fragment：UNP residues 59-325	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；277 K；10% w/v PEG3000, 200 mM zinc acetate, 100 mM sodium acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.95 Å R-free 0.241
4FQR Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin Deposited 2012-06-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 27–345（319 aa） Fragment：UNP residues 27-345 Chain B 346–519（174 aa） Fragment：UNP residues 346-519 Chain C 27–345（319 aa） Fragment：UNP residues 27-345 Chain D 346–519（174 aa） Fragment：UNP residues 346-519 Chain E 27–345（319 aa） Fragment：UNP residues 27-345 Chain F 346–519（174 aa） Fragment：UNP residues 346-519	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28% w/v PEG400, 200 mM calcium chloride, 100 mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 4.10 Å R-free 0.334
4FQR Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin Deposited 2012-06-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 27–345（319 aa） Fragment：UNP residues 27-345 Chain H 346–519（174 aa） Fragment：UNP residues 346-519 Chain I 27–345（319 aa） Fragment：UNP residues 27-345 Chain J 346–519（174 aa） Fragment：UNP residues 346-519 Chain K 27–345（319 aa） Fragment：UNP residues 27-345 Chain L 346–519（174 aa） Fragment：UNP residues 346-519	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28% w/v PEG400, 200 mM calcium chloride, 100 mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 4.10 Å R-free 0.334
4FQR Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin Deposited 2012-06-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain M 27–345（319 aa） Fragment：UNP residues 27-345 Chain N 346–519（174 aa） Fragment：UNP residues 346-519 Chain O 27–345（319 aa） Fragment：UNP residues 27-345 Chain P 346–519（174 aa） Fragment：UNP residues 346-519 Chain Q 27–345（319 aa） Fragment：UNP residues 27-345 Chain R 346–519（174 aa） Fragment：UNP residues 346-519	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28% w/v PEG400, 200 mM calcium chloride, 100 mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 4.10 Å R-free 0.334
4FQR Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin Deposited 2012-06-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain S 27–345（319 aa） Fragment：UNP residues 27-345 Chain T 346–519（174 aa） Fragment：UNP residues 346-519 Chain U 27–345（319 aa） Fragment：UNP residues 27-345 Chain V 346–519（174 aa） Fragment：UNP residues 346-519 Chain W 27–345（319 aa） Fragment：UNP residues 27-345 Chain X 346–519（174 aa） Fragment：UNP residues 346-519	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28% w/v PEG400, 200 mM calcium chloride, 100 mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 4.10 Å R-free 0.334
4FQY Crystal structure of broadly neutralizing antibody CR9114 bound to H3 influenza hemagglutinin Deposited 2012-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 27–345（319 aa） Fragment：UNP residues 27-345 Chain B 346–519（174 aa） Fragment：UNP residues 346-519	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；293 K；200 mM zinc acetate, 14% PEG1000, 100 mM sodium acetate, pH 4.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 5.25 Å R-free 0.374
4NM8 Crystal structure of broadly neutralizing antibody CR8043 bound to H3 influenza hemagglutinin Deposited 2013-11-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 27–345（319 aa） Chain B 346–521（176 aa） Chain C 27–345（319 aa） Chain D 346–521（176 aa） Chain E 27–345（319 aa） Chain F 346–521（176 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277 K；2.2 M ammonium sulfate, 0.1 M sodium acetate pH 5.5, 3% PEG 400, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 4.00 Å R-free 0.292
4UBD Crystal structure of a neutralizing human monoclonal antibody with 1968 H3 HA Deposited 2014-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 25–344（320 aa） Chain B 346–520（175 aa） Chain E 25–344（320 aa） Chain F 346–520（175 aa） Chain I 25–344（320 aa） Chain J 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；20% PEG 3000, 100mM Na Citrate	Resolution 3.50 Å R-free 0.258
4UBD Crystal structure of a neutralizing human monoclonal antibody with 1968 H3 HA Deposited 2014-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain M 25–344（320 aa） Chain N 346–520（175 aa） Chain Q 25–344（320 aa） Chain R 346–520（175 aa） Chain U 25–344（320 aa） Chain V 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；20% PEG 3000, 100mM Na Citrate	Resolution 3.50 Å R-free 0.258
4WE4 The crystal structure of hemagglutinin from 1968 H3N2 influenza virus Deposited 2014-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 25–345（321 aa） Fragment：unp residues 25-345 Chain B 346–517（172 aa） Fragment：unp residues 346-517	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 PEG DI(HYDROXYETHYL)ETHER × 21 PE5 3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL × 3	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 7.9；293 K；0.1M Tris-HCl, 25% PEG1000	Resolution 2.35 Å R-free 0.236
4ZCJ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin HA1 Cys30, HA2 Cys47 mutant Deposited 2015-04-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Fragment：HA1 chain (UNP residues 27-345) Chain B 346–521（176 aa） Fragment：HA2 chain (UNP residues 346-521) Chain C 27–345（319 aa） Fragment：HA1 chain (UNP residues 27-345) Chain D 346–521（176 aa） Fragment：HA2 chain (UNP residues 346-521) Chain E 27–345（319 aa） Fragment：HA1 chain (UNP residues 27-345) Chain F 346–521（176 aa） Fragment：HA2 chain (UNP residues 346-521)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；8% PEG 8000, 0.1 M HEPES pH 7	Resolution 3.00 Å R-free 0.275
5K9K Crystal structure of multidonor HV6-1-class broadly neutralizing Influenza A antibody 56.a.09 in complex with Hemagglutinin Hong Kong 1968. Deposited 2016-05-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 17–519（503 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.28M ammonium citrate, pH 8.5, and 12.5% (w/v) PEG-8000	Resolution 2.97 Å R-free 0.265
5K9K Crystal structure of multidonor HV6-1-class broadly neutralizing Influenza A antibody 56.a.09 in complex with Hemagglutinin Hong Kong 1968. Deposited 2016-05-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 17–519（503 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.28M ammonium citrate, pH 8.5, and 12.5% (w/v) PEG-8000	Resolution 2.97 Å R-free 0.265
5K9Q Crystal structure of multidonor HV1-18-class broadly neutralizing Influenza A antibody 16.a.26 in complex with A/Hong Kong/1-4-MA21-1/1968 (H3N2) Hemagglutinin Deposited 2016-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 24–343（320 aa） Chain B 348–517（170 aa） Chain C 24–343（320 aa） Chain D 348–517（170 aa） Chain E 24–343（320 aa） Chain F 348–517（170 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.01M L-cysteine, 0.09M sodium cacodylate, pH 6.5, 0.18M magnesium acetate, and 7.9% (w/v) PEG-8000	Resolution 2.50 Å R-free 0.218
5K9Q Crystal structure of multidonor HV1-18-class broadly neutralizing Influenza A antibody 16.a.26 in complex with A/Hong Kong/1-4-MA21-1/1968 (H3N2) Hemagglutinin Deposited 2016-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain M 24–343（320 aa） Chain N 348–517（170 aa） Chain O 24–343（320 aa） Chain P 348–517（170 aa） Chain Q 24–343（320 aa） Chain R 348–517（170 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.01M L-cysteine, 0.09M sodium cacodylate, pH 6.5, 0.18M magnesium acetate, and 7.9% (w/v) PEG-8000	Resolution 2.50 Å R-free 0.218
5KAN Crystal structure of multidonor HV1-18-class broadly neutralizing Influenza A antibody 16.g.07 in complex with A/Hong Kong/1-4-MA21-1/1968 (H3N2) Hemagglutinin Deposited 2016-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 24–342（319 aa） Chain B 349–521（173 aa） Chain C 24–342（319 aa） Chain D 349–521（173 aa） Chain E 24–342（319 aa） Chain F 349–521（173 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；0.010M Tris(2-carboxyethyl)phosphine HCl (TCEP) , 0.09 M 2-(N-morpholino)ethanesulfonic acid (MES), pH 6.0, 12% (w/v) PEG-6000	Resolution 2.79 Å R-free 0.243
5KUY Influenza hemagglutinin H3 A/Hong Kong/1/1968 in complex with designed inhibitor protein HSB.2A Deposited 2016-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 27–345（319 aa） Chain B 346–521（176 aa） Chain C 27–345（319 aa） Chain D 346–521（176 aa） Chain E 27–345（319 aa） Chain F 346–521（176 aa）	Mutation：R452G Mutation：R452G Mutation：R452G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；10% PEG 6000, 100 mM MES pH 6.0	Resolution 2.60 Å R-free 0.204
5T6N Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin in complex with the antiviral drug arbidol Deposited 2016-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain C 27–345（319 aa） Chain E 27–345（319 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7 75U ethyl 6-bromo-4-[(dimethylamino)methyl]-5-hydroxy-1-methyl-2-[(phenylsulfanyl)methyl]-1H-indole-3-carboxylate × 3 SO4 SULFATE ION × 4 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；2.0 M ammonium sulfate, 100 mM sodium cacodylate, 200 mM sodium chloride	Resolution 2.54 Å R-free 0.220
5THF Crystal structure of H3 hemagglutinin with insertion of two amino acids in the 150-loop from the A/Hong Kong/1/1968 (H3N2) influenza virus Deposited 2016-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–521（176 aa） Chain C 27–345（319 aa） Chain D 346–521（176 aa） Chain E 27–345（319 aa） Chain F 346–521（176 aa）	Mutation：Insertion Mutation：R468G Mutation：Insertion Mutation：R468G Mutation：Insertion Mutation：R468G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293.15 K；20% (w/v) PEG 3500, 0.2M Na2HPO4 pH 9.1	Resolution 2.59 Å R-free 0.239
5UMN Crystal structure of C05 VPGSGW mutant bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2017-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 59–325（267 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 1PE PENTAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.1 M sodium citrate pH 5.5 and 9% PEG 8000	Resolution 1.97 Å R-free 0.208
5UMN Crystal structure of C05 VPGSGW mutant bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2017-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 59–325（267 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 1PE PENTAETHYLENE GLYCOL × 3 NA SODIUM ION × 1 FLC CITRATE ANION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.1 M sodium citrate pH 5.5 and 9% PEG 8000	Resolution 1.97 Å R-free 0.208
5VTQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 3'-SLN Deposited 2017-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.95 Å R-free 0.228
5VTQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 3'-SLN Deposited 2017-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.95 Å R-free 0.228
5VTQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 3'-SLN Deposited 2017-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.95 Å R-free 0.228
5VTQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 3'-SLN Deposited 2017-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225L/L226S Mutation：G225L/L226S Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.95 Å R-free 0.228
5VTR Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.50 Å R-free 0.213
5VTR Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.50 Å R-free 0.213
5VTR Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.50 Å R-free 0.213
5VTR Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225L/L226S Mutation：G225L/L226S Mutation：G225L/L226S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SIA N-acetyl-alpha-neuraminic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.50 Å R-free 0.213
5VTU Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M potassium nitrate and 20% PEG 3350	Resolution 2.45 Å R-free 0.220
5VTU Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M potassium nitrate and 20% PEG 3350	Resolution 2.45 Å R-free 0.220
5VTU Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M potassium nitrate and 20% PEG 3350	Resolution 2.45 Å R-free 0.220
5VTU Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225L/L226S mutant apo form Deposited 2017-05-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M potassium nitrate and 20% PEG 3350	Resolution 2.45 Å R-free 0.220
5VTV Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.212
5VTV Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.212
5VTV Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.212
5VTV Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225M/L226T/S228A Mutation：G225M/L226T/S228A Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.212
5VTW Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.35 Å R-free 0.213
5VTW Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.35 Å R-free 0.213
5VTW Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.35 Å R-free 0.213
5VTW Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225M/L226T/S228A Mutation：G225M/L226T/S228A Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 SIA N-acetyl-alpha-neuraminic acid × 1 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.35 Å R-free 0.213
5VTX Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.65 Å R-free 0.217
5VTX Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.65 Å R-free 0.217
5VTX Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.65 Å R-free 0.217
5VTX Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225M/L226T/S228A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225M/L226T/S228A Mutation：G225M/L226T/S228A Mutation：G225M/L226T/S228A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.65 Å R-free 0.217
5VTY Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Mutation：G225Q/L226A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.36 Å R-free 0.210
5VTY Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Mutation：G225Q/L226A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.36 Å R-free 0.210
5VTY Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225Q/L226A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.36 Å R-free 0.210
5VTY Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 3'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225Q/L226A Mutation：G225Q/L226A Mutation：G225Q/L226A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.36 Å R-free 0.210
5VTZ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Mutation：G225Q/L226A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.15 Å R-free 0.199
5VTZ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Mutation：G225Q/L226A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.15 Å R-free 0.199
5VTZ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225Q/L226A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.15 Å R-free 0.199
5VTZ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant apo form Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：G225Q/L226A Mutation：G225Q/L226A Mutation：G225Q/L226A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.15 Å R-free 0.199
5VU4 Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–345（319 aa） Chain B 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
5VU4 Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–345（319 aa） Chain D 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
5VU4 Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SIA N-acetyl-alpha-neuraminic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
5VU4 Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin G225Q/L226A mutant in complex with 6'-SLN Deposited 2017-05-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SIA N-acetyl-alpha-neuraminic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
6BKM Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D mutant apo form Deposited 2017-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 27–345（319 aa） Chain C 27–345（319 aa） Chain E 27–345（319 aa）	Mutation：E190D Mutation：E190D Mutation：E190D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 6% PEG 8000, and 39% 2-methyl-2,4-pentanediol	Resolution 2.20 Å R-free 0.209
6BKM Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D mutant apo form Deposited 2017-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain C 27–345（319 aa） Chain E 27–345（319 aa）	Mutation：E190D Mutation：E190D Mutation：E190D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 6% PEG 8000, and 39% 2-methyl-2,4-pentanediol	Resolution 2.20 Å R-free 0.209
6BKQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D mutant in complex with 6'-SLN Deposited 2017-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 27–345（319 aa） Chain C 27–345（319 aa） Chain E 27–345（319 aa）	Mutation：E190D Mutation：E190D Mutation：E190D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 6% PEG 8000, and 39% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
6BKQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D mutant in complex with 6'-SLN Deposited 2017-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain B 346–519（174 aa） Chain D 346–519（174 aa） Chain F 346–519（174 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 6% PEG 8000, and 39% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
6BKQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D mutant in complex with 6'-SLN Deposited 2017-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain B 346–519（174 aa） Chain C 27–345（319 aa） Chain D 346–519（174 aa） Chain E 27–345（319 aa） Chain F 346–519（174 aa）	Mutation：E190D Mutation：E190D Mutation：E190D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 6% PEG 8000, and 39% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
6CEX Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin in complex with small molecule N-Cyclohexyltaurine Deposited 2018-02-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Chain C 27–345（319 aa） Chain E 27–345（319 aa）	Not recorded	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 SO4 SULFATE ION × 6 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；2.0 M ammonium sulfate, 100 mM sodium cacodylate, 200 mM sodium chloride, pH 6.5, 20 degree	Resolution 2.57 Å R-free 0.204
6D0U Crystal structure of C05 V110P/A117E mutant bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2018-04-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 59–325（267 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.1 M sodium citrate pH 5.5 and 20% PEG 3000	Resolution 3.25 Å R-free 0.268
6D0U Crystal structure of C05 V110P/A117E mutant bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2018-04-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 59–325（267 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.1 M sodium citrate pH 5.5 and 20% PEG 3000	Resolution 3.25 Å R-free 0.268
6D0U Crystal structure of C05 V110P/A117E mutant bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2018-04-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 59–325（267 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.1 M sodium citrate pH 5.5 and 20% PEG 3000	Resolution 3.25 Å R-free 0.268
6D0U Crystal structure of C05 V110P/A117E mutant bound to H3 influenza hemagglutinin, HA1 subunit Deposited 2018-04-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 59–325（267 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.1 M sodium citrate pH 5.5 and 20% PEG 3000	Resolution 3.25 Å R-free 0.268
6NHP Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin HA2 I45T mutant Deposited 2018-12-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 346–521（176 aa） Fragment：residues 346-521 Chain D 346–521（176 aa） Fragment：residues 346-521 Chain F 346–521（176 aa） Fragment：residues 346-521	Mutation：I45T Mutation：I45T Mutation：I45T	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.25 Å R-free 0.208
6NHQ Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin HA2 I45M mutant Deposited 2018-12-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Fragment：residues 27-345 Chain B 346–521（176 aa） Fragment：residues 346-521 Chain C 27–345（319 aa） Fragment：residues 27-345 Chain D 346–521（176 aa） Fragment：residues 346-521 Chain E 27–345（319 aa） Fragment：residues 27-345 Chain F 346–521（176 aa） Fragment：residues 346-521	Mutation：I45M Mutation：I45M Mutation：I45M	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.50 Å R-free 0.219
6NHR Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin HA2 I45F mutant Deposited 2018-12-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 346–521（176 aa） Fragment：residues 346-521 Chain D 346–521（176 aa） Fragment：residues 346-521 Chain F 346–521（176 aa） Fragment：residues 346-521	Mutation：I45F Mutation：I45F Mutation：I45F	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 5% PEG 8000, and 38% 2-methyl-2,4-pentanediol	Resolution 2.10 Å R-free 0.216
6NZ7 Crystal structure of broadly neutralizing Influenza A antibody 429 B01 in complex with Hemagglutinin Hong Kong 1968 Deposited 2019-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 24–342（319 aa） Fragment：residues 24-342 Chain B 349–521（173 aa） Fragment：residues 349-521	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；300 K；10 % PEG8000 (w/v), 100 mM Tris/Cl, pH 8.5 and 7.5 % 1,6-hexanediol (w/v)	Resolution 2.95 Å R-free 0.267
6NZ7 Crystal structure of broadly neutralizing Influenza A antibody 429 B01 in complex with Hemagglutinin Hong Kong 1968 Deposited 2019-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 24–342（319 aa） Fragment：residues 24-342 Chain F 349–521（173 aa） Fragment：residues 349-521	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；300 K；10 % PEG8000 (w/v), 100 mM Tris/Cl, pH 8.5 and 7.5 % 1,6-hexanediol (w/v)	Resolution 2.95 Å R-free 0.267
6OCB Crystal structure of FluA-20 Fab in complex with the head domain of H3 (A/Hong Kong/1/1968) Deposited 2019-03-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 59–325（267 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.1 M Tris-HCl pH 8.5 0.2 M lithium sulfate 40% (v/v) PEG400	Resolution 2.10 Å R-free 0.239
6TZB Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin in complex with 6'-SLNLN Deposited 2019-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 27–345（319 aa） Fragment：residues 27-345 Chain C 27–345（319 aa） Fragment：residues 27-345 Chain E 27–345（319 aa） Fragment：residues 27-345	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.1 M sodium cacodylate pH 6.5, 6% PEG 8000, and 39% 2-methyl-2,4-pentanediol	Resolution 2.24 Å R-free 0.207
6WXB Cryo-EM Structure of Influenza Hemagglutinin (HA) Trimer Vitrified Using Back-it-up Deposited 2020-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 17–527（511 aa） Chain B 17–527（511 aa） Chain C 17–527（511 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 BMA beta-D-mannopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；Back-it-up (ultrasonic specimen application and through-grid wicking in a high-speed specimen preparation device) was used	Resolution 2.90 Å
7K37 Structure of full-length influenza HA with a head-binding antibody at pH 7.8 Deposited 2020-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–345（345 aa） Chain C 1–345（345 aa） Chain E 1–345（345 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7K39 Structure of full-length influenza HA with a head-binding antibody at pH 5.2, conformation A, neutral pH-like Deposited 2020-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–345（345 aa） Chain C 1–345（345 aa） Chain E 1–345（345 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 5.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7K3A Structure of full-length influenza HA with a head-binding antibody at pH 5.2, conformation B, fusion peptide release Deposited 2020-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–345（345 aa） Chain C 1–345（345 aa） Chain E 1–345（345 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 5.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
7K3B Structure of full-length influenza HA with a head-binding antibody at pH 5.2, conformation C, central helices splay Deposited 2020-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–345（345 aa） Chain C 1–345（345 aa） Chain E 1–345（345 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 5.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7QA4 Crystal structure of stabilized H3N2 A/Hong Kong/1/1968 Hemagglutinin at 2.2 Angstrom Deposited 2021-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 17–521（505 aa） Fragment：Hemagglutinin	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 NO3 NITRATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20.00 %w/v PEG 3350, 0.2 M LiNO3	Resolution 2.19 Å R-free 0.251
7RDH Crystal structure of the de novo designed binding protein H3mb in complex with the 1968 influenza A virus hemagglutinin Deposited 2021-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 27–345（319 aa） Chain B 346–521（176 aa） Chain C 27–345（319 aa） Chain D 346–521（176 aa） Chain E 27–345（319 aa） Chain F 346–521（176 aa）	Mutation：R123G Mutation：R123G Mutation：R123G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2M sodium thiocyanate and 20% (w/v) polyethylene glycol 3350 as a precipitant	Resolution 2.75 Å R-free 0.289
7VDF 2.56 A structure of influenza hemagglutinin (HA) trimer Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 17–527（511 aa） Chain B 17–527（511 aa） Chain C 17–527（511 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 BMA beta-D-mannopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.56 Å
7X6L Cryo-EM structure of H3 hemagglutinin from A/HongKong/01/1968 in complex with a neutralizing antibody 28-12 Deposited 2022-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 17–345（329 aa） Chain C 17–345（329 aa） Chain D 17–345（329 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8PK3 CryoEM reconstruction of hemagglutinin HK68 of Influenza A virus bound to an Affimer reagent Deposited 2023-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 27–344（318 aa） Chain B 27–344（318 aa） Chain C 27–344（318 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9CXT Hemagglutinin A/Hong Kong/1/68 produced in GnTI- cells Deposited 2024-07-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 345–524（180 aa） Chain C 17–344（328 aa） Chain D 345–524（180 aa） Chain E 17–344（328 aa） Chain F 345–524（180 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；TBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9CXU Endo H-treated hemagglutinin A/Hong Kong/1/68 Deposited 2024-07-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 345–524（180 aa） Chain C 17–344（328 aa） Chain D 345–524（180 aa） Chain E 17–344（328 aa） Chain F 345–524（180 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；TBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.30 Å

46 other PDB entries and 90 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HEMA_I68A4
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 5–323； UniProt 27–345 Author chain C； PDBConstruct 5–323； UniProt 27–345 Author chain E； PDBConstruct 5–323； UniProt 27–345 Author chain B； PDBConstruct 1–174； UniProt 346–519 Author chain D； PDBConstruct 1–174； UniProt 346–519 Author chain F； PDBConstruct 1–174； UniProt 346–519

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4fnk
Deposition date deposition_date	2012-06-19
Structure title title	Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin
Keywords keywords	viral fusion protein, virus attachment and entry, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	41.52 Å
Radius of gyration Rg (electron density) rg_electron	40.94 Å
Forward intensity I(0) i0	466731000.00
Molecular weight molecular_weight	170350.0 kDa
Excluded volume excluded_volume	210390 Å³
Envelope volume envelope_volume	270900 Å³
Hydration-shell volume shell_volume	56937 Å³
Envelope diameter envelope_diameter	139.0 Å
Shell Rg shell_rg	44.72 Å
Envelope Rg envelope_rg	40.60 Å
Shape Rg shape_rg	40.93 Å
Total Rg total_rg	41.14 Å
Total atoms total_atoms	11960
Residues n_residues	1467
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	139.1 Å
Rg (real space) rg_real	41.74 Å
Rg uncertainty (real space) rg_real_error	1.36 Å
I(0) (real space) i0_real	4.6670e+08
I(0) uncertainty (real space) i0_real_error	8.0670e+06
Rg (reciprocal space) rg_reciprocal	41.52 Å
I(0) (reciprocal space) i0_reciprocal	466600000.0000
Solution quality estimate total_estimate	0.8424
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	40.3 Å
Skewness Skewness skewness	0.491
Kurtosis Kurtosis kurtosis	-0.451
Angular range angular_range	— – 0.1900 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	50720000.0000
Real-space data points n_real_points	39
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.746; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.970; Smooth: 0.739

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Hemagglutinin HA1 chain
Molecular weight formula_weight	35506.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	14165

ADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTR

来源 Source

来源生物 organism	Influenza A virus
NCBI Class编号 ncbi_taxonomy_id	506350
宿主生物 host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Hemagglutinin HA2 chain
Molecular weight formula_weight	20041.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIK

来源 Source

来源生物 organism	Influenza A virus
NCBI Class编号 ncbi_taxonomy_id	506350
宿主生物 host_organism	Trichoplusia ni

Entity 3 Entity 3 branched

Description description	;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	748.7 kDa
Source method src_method	man
Copy count entity_count	1

Entity 4 Entity 4 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	6

Entity 5 Entity 5 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	1

Entity 6 Entity 6 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	man
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	7

Entity 8 Entity 8 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 9 Entity 9 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1707

▼

7. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (9 domains)

Domain ID domain_id	d4fnka1
Class class	b — All beta proteins
Fold Fold fold	b.19 — Viral protein domain
Superfamily Superfamily superfamily	b.19.1 — Viral protein domain
Family Family family	b.19.1.2 — Influenza hemagglutinin headpiece

Domain ID domain_id	d4fnka2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4fnkb_
Class class	h — Coiled coil proteins
Fold Fold fold	h.3 — Stalk segment of viral fusion proteins
Superfamily Superfamily superfamily	h.3.1 — Influenza hemagglutinin (stalk)
Family Family family	h.3.1.1 — Influenza hemagglutinin (stalk)

Domain ID domain_id	d4fnkc1
Class class	b — All beta proteins
Fold Fold fold	b.19 — Viral protein domain
Superfamily Superfamily superfamily	b.19.1 — Viral protein domain
Family Family family	b.19.1.2 — Influenza hemagglutinin headpiece

Domain ID domain_id	d4fnkc2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4fnkd_
Class class	h — Coiled coil proteins
Fold Fold fold	h.3 — Stalk segment of viral fusion proteins
Superfamily Superfamily superfamily	h.3.1 — Influenza hemagglutinin (stalk)
Family Family family	h.3.1.1 — Influenza hemagglutinin (stalk)

Domain ID domain_id	d4fnke1
Class class	b — All beta proteins
Fold Fold fold	b.19 — Viral protein domain
Superfamily Superfamily superfamily	b.19.1 — Viral protein domain
Family Family family	b.19.1.2 — Influenza hemagglutinin headpiece

Domain ID domain_id	d4fnke2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4fnkf_
Class class	h — Coiled coil proteins
Fold Fold fold	h.3 — Stalk segment of viral fusion proteins
Superfamily Superfamily superfamily	h.3.1 — Influenza hemagglutinin (stalk)
Family Family family	h.3.1.1 — Influenza hemagglutinin (stalk)

CATH v4.4 (6 domains)

Domain ID domain_id	4fnkA01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	209 — Hemagglutinin (Ha1 Chain); Chain: A; domain 1
Homologous superfamily homologous superfamily	20 — Haemagglutinin, alpha/beta domain, HA1 chain

Domain ID domain_id	4fnkB00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	20 — Hemagglutinin Ectodomain; Chain B
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4fnkC01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	209 — Hemagglutinin (Ha1 Chain); Chain: A; domain 1
Homologous superfamily homologous superfamily	20 — Haemagglutinin, alpha/beta domain, HA1 chain

Domain ID domain_id	4fnkD00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	20 — Hemagglutinin Ectodomain; Chain B
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4fnkE01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	209 — Hemagglutinin (Ha1 Chain); Chain: A; domain 1
Homologous superfamily homologous superfamily	20 — Haemagglutinin, alpha/beta domain, HA1 chain

Domain ID domain_id	4fnkF00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	20 — Hemagglutinin Ectodomain; Chain B
Homologous superfamily homologous superfamily	10 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	105.149 Å
Unit-cell length b length_b	151.458 Å
Unit-cell length c length_c	347.751 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	1.901 Å
Low-resolution limit resolution_low	43.064 Å
R factor r_factor	0.1629
R_work r_work	0.1616
R_free r_free	0.1885

fit	/app/data/saxs_computation/fn/4fnk/4fnk.fit
pddf	/app/data/pr_computation/fn/4fnk/4fnk.pr.out
profile	/app/data/saxs_computation/fn/4fnk/4fnk.dat

Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemagglutinin HA1 chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 water

7. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (9 domains)

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)