SAXSdb — 4gip

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

Simian virus 5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	2-acetamido-2-deoxy-beta-D-glucopyranose × 11 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FUS_SV5
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–81； UniProt 20–100 Author chain B； PDBConstruct 1–81； UniProt 20–100 Author chain C； PDBConstruct 1–81； UniProt 20–100 Author chain D； PDBConstruct 1–375； UniProt 103–477 Author chain E； PDBConstruct 1–375； UniProt 103–477 Author chain F； PDBConstruct 1–375； UniProt 103–477

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4gip
Deposition date deposition_date	2012-08-08
Structure title title	Structure of the cleavage-activated prefusion form of the parainfluenza virus 5 (PIV5) fusion protein
Keywords keywords	;PIV5, viral fusion protein, membrane fusion, protease cleavage-activated form, ectodomain, trimer, HN (hemagglutinin-neuraminidase), VIRAL PROTEIN ;; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4gip__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4gip__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4gip__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	35.23 Å
Rg (electron density)	34.19 Å
Total Rg	34.81 Å
Atom count	10384
Residues	1368
Excluded volume	187830 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4gip__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F2
Molecular weight formula_weight	8956.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	11335

LDPAALMQIGVIPTNVRQLMYYTEASSAFIVVKLMPTIDSPISGCNITSISSYNATVTKLLQPIGENLETIRNQLIPTRRR

Source Source

Source organism organism	Simian virus 5
Common name common_name	SV5
NCBI taxonomy ID ncbi_taxonomy_id	11208
Host organism host_organism	TRICHOPLUSIA NI

Entity 2 Entity 2 polymer

Description description	Fusion glycoprotein F1
Molecular weight formula_weight	43942.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

FAGVVIGLAALGVATAAQVTAAVALVKANENAAAILNLKNAIQKTNAAVADVVQATQSLGTAVQAVQDHINSVVSPAITAANCKAQDAIIGSILNLYLTELTTIFHNQITNPALSPITIQALRILLGSTLPTVVEKSFNTQISAAELLSSGLLTGQIVGLDLTYMQMVIKIELPTLTVQPATQIIDLATISAFINNQEVMAQLPTRVMVTGSLIQAYPASQCTITPNTVYCRYNDAQVLSDDTMACLQGNLTRCTFSPVVGSFLTRFVLFDGIVYANCRSMLCKCMQPAAVILQPSSSPVTVIDMYKCVSLQLDNLRFTITQLANVTYNSTIKLESSQILSIDPLDISQNLAAVNKSLSDALQHLAQSDTYLSAIEDKIEEILSKIYHIENEIARIKKLIGEAHHHHHH

Source Source

Source organism organism	Simian virus 5
Common name common_name	SV5
NCBI taxonomy ID ncbi_taxonomy_id	11208
Host organism host_organism	TRICHOPLUSIA NI

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	11

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	951

▼

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

Domain ID domain_id	4gipA00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	10 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 —

Domain ID domain_id	4gipB00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	10 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 —

Domain ID domain_id	4gipC00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	10 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 —

Domain ID domain_id	4gipD02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	490 — Head and neck region of the ectodomain of NDV fusion glycoprotein
Homologous superfamily homologous superfamily	10 — Newcastle disease virus like domain

Domain ID domain_id	4gipD03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1690 — Head and neck region of the ectodomain of NDV fusion glycoprotein

Domain ID domain_id	4gipE02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	490 — Head and neck region of the ectodomain of NDV fusion glycoprotein
Homologous superfamily homologous superfamily	10 — Newcastle disease virus like domain

Domain ID domain_id	4gipE03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1690 — Head and neck region of the ectodomain of NDV fusion glycoprotein

Domain ID domain_id	4gipF02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	490 — Head and neck region of the ectodomain of NDV fusion glycoprotein
Homologous superfamily homologous superfamily	10 — Newcastle disease virus like domain

Domain ID domain_id	4gipF03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1690 — Head and neck region of the ectodomain of NDV fusion glycoprotein

▶

Unit-cell length a length_a	250.930 Å
Unit-cell length b length_b	140.520 Å
Unit-cell length c length_c	84.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	99.84 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	35.540 Å
R factor r_factor	0.2210
R_work r_work	0.2200
R_free r_free	0.2430

Structure of the cleavage-activated prefusion form of the parainfluenza virus 5 (PIV5) fusion protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4gip__assembly_1__model_1

4gip__assembly_1__model_1 | I(q)

4gip__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

7. Citations (1)

Structure of the cleavage-activated prefusion form of the parainfluenza virus 5 (PIV5) fusion protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4gip__assembly_1__model_1

4gip__assembly_1__model_1 | I(q)

4gip__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

7. Citations (1)