SAXSdb — 4hil

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b5 type B

Rattus norvegicus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 17–102	Not recorded	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 6.5；293 K；30% (w/v) PEG 8000, 100 sodium cacodylate, 200 mM sodium acetate, pH 6.5, vapor diffusion, temperature 293K	Resolution 1.25 Å R-free 0.152
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 17–102	Not recorded	HEM PROTOPORPHYRIN IX CONTAINING FE × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 6.5；293 K；30% (w/v) PEG 8000, 100 sodium cacodylate, 200 mM sodium acetate, pH 6.5, vapor diffusion, temperature 293K	Resolution 1.25 Å R-free 0.152

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4HIL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AWP RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 1997-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 13–103（91 aa） Fragment：WATER SOLUBLE DOMAIN Chain B 13–103（91 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：V45L, V61L Mutation：V45L, V61L	HEM PROTOPORPHYRIN IX CONTAINING FE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å R-free 0.225
1B5M RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 1996-11-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–102（84 aa） Fragment：WATER SOLUBLE DOMAIN	Not recorded	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions vapor diffusion with slow evaporation；pH 6.5；CRYSTALS WERE OBTAINED BY VAPOR DIFFUSION TOGETHER WITH SLOW EVAPORATION USING 20% PEG 8000 IN 0.1M SODIUM CACODYLATE (PH = 6.5 WITH 0.2 M MAGNESIUM ACETATE., vapor diffusion with slow evaporation	Resolution 2.70 Å
1EUE RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 2000-04-19	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 6–91（86 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：V45I, V61I	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；20% PEG 8000, 0.2 M magnesium acetate, 0.1 M PIPES, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K	Resolution 1.80 Å R-free 0.232
1EUE RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 2000-04-19	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 6–91（86 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：V45I, V61I	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；20% PEG 8000, 0.2 M magnesium acetate, 0.1 M PIPES, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K	Resolution 1.80 Å R-free 0.232
1ICC RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 2001-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–103（87 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：A18S, I32L, L47R	MG MAGNESIUM ION × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000 Magnesium Acetate PIPES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.240
1ICC RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 2001-03-30	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 17–103（87 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：A18S, I32L, L47R	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000 Magnesium Acetate PIPES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.240
1ICC RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 2001-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 17–103（87 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：A18S, I32L, L47R	MG MAGNESIUM ION × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000 Magnesium Acetate PIPES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.240
1ICC RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 2001-03-30	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 17–103（87 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：A18S, I32L, L47R	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000 Magnesium Acetate PIPES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.240
1ICC RAT OUTER MITOCHONDRIAL MEMBRANE CYTOCHROME B5 Deposited 2001-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 17–103（87 aa） Fragment：WATER SOLUBLE DOMAIN Chain C 17–103（87 aa） Fragment：WATER SOLUBLE DOMAIN	Mutation：A18S, I32L, L47R Mutation：A18S, I32L, L47R	MG MAGNESIUM ION × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000 Magnesium Acetate PIPES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.240
1LJ0 Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5. Deposited 2002-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 12–103（92 aa） Fragment：water soluble domain Chain B 12–103（92 aa） Fragment：water soluble domain	Mutation：A18S, I25L, I32L, L47R, L71S Mutation：A18S, I25L, I32L, L47R, L71S	MG MAGNESIUM ION × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000, MG ACETATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.251
1LJ0 Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5. Deposited 2002-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 12–103（92 aa） Fragment：water soluble domain Chain C 12–103（92 aa） Fragment：water soluble domain	Mutation：A18S, I25L, I32L, L47R, L71S Mutation：A18S, I25L, I32L, L47R, L71S	HEM PROTOPORPHYRIN IX CONTAINING FE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000, MG ACETATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.251
1LJ0 Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5. Deposited 2002-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 12–103（92 aa） Fragment：water soluble domain Chain D 12–103（92 aa） Fragment：water soluble domain	Mutation：A18S, I25L, I32L, L47R, L71S Mutation：A18S, I25L, I32L, L47R, L71S	MG MAGNESIUM ION × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000, MG ACETATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.251
1LJ0 Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5. Deposited 2002-04-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 12–103（92 aa） Fragment：water soluble domain	Mutation：A18S, I25L, I32L, L47R, L71S	MG MAGNESIUM ION × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000, MG ACETATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.251
1LJ0 Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5. Deposited 2002-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 12–103（92 aa） Fragment：water soluble domain Chain C 12–103（92 aa） Fragment：water soluble domain	Mutation：A18S, I25L, I32L, L47R, L71S Mutation：A18S, I25L, I32L, L47R, L71S	HEM PROTOPORPHYRIN IX CONTAINING FE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000, MG ACETATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.251
1LJ0 Structure of quintuple mutant of the rat outer mitocondrial cytochrome b5. Deposited 2002-04-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 12–103（92 aa） Fragment：water soluble domain	Mutation：A18S, I25L, I32L, L47R, L71S	MG MAGNESIUM ION × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；278 K；PEG 8000, MG ACETATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.00 Å R-free 0.251
2I89 Structure of septuple mutant of Rat Outer Mitochondrial Membrane Cytochrome B5 Deposited 2006-09-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 12–103（92 aa） Fragment：Water Soluble Domain	Mutation：R15H/A18S/E20S/I25L/I32L/L47R/L71S	MG MAGNESIUM ION × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；278 K；PEG8K 30%, O.2M MgAc, 0.1M Pipes, VAPOR DIFFUSION, HANGING DROP, temperature 278K, pH 6.80	Resolution 2.10 Å R-free 0.278
2I89 Structure of septuple mutant of Rat Outer Mitochondrial Membrane Cytochrome B5 Deposited 2006-09-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 12–103（92 aa） Fragment：Water Soluble Domain	Mutation：R15H/A18S/E20S/I25L/I32L/L47R/L71S	MG MAGNESIUM ION × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；278 K；PEG8K 30%, O.2M MgAc, 0.1M Pipes, VAPOR DIFFUSION, HANGING DROP, temperature 278K, pH 6.80	Resolution 2.10 Å R-free 0.278
2I89 Structure of septuple mutant of Rat Outer Mitochondrial Membrane Cytochrome B5 Deposited 2006-09-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 12–103（92 aa） Fragment：Water Soluble Domain	Mutation：R15H/A18S/E20S/I25L/I32L/L47R/L71S	MG MAGNESIUM ION × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；278 K；PEG8K 30%, O.2M MgAc, 0.1M Pipes, VAPOR DIFFUSION, HANGING DROP, temperature 278K, pH 6.80	Resolution 2.10 Å R-free 0.278
2I89 Structure of septuple mutant of Rat Outer Mitochondrial Membrane Cytochrome B5 Deposited 2006-09-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 12–103（92 aa） Fragment：Water Soluble Domain	Mutation：R15H/A18S/E20S/I25L/I32L/L47R/L71S	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；278 K；PEG8K 30%, O.2M MgAc, 0.1M Pipes, VAPOR DIFFUSION, HANGING DROP, temperature 278K, pH 6.80	Resolution 2.10 Å R-free 0.278
2I89 Structure of septuple mutant of Rat Outer Mitochondrial Membrane Cytochrome B5 Deposited 2006-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 12–103（92 aa） Fragment：Water Soluble Domain Chain C 12–103（92 aa） Fragment：Water Soluble Domain	Mutation：R15H/A18S/E20S/I25L/I32L/L47R/L71S Mutation：R15H/A18S/E20S/I25L/I32L/L47R/L71S	MG MAGNESIUM ION × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；278 K；PEG8K 30%, O.2M MgAc, 0.1M Pipes, VAPOR DIFFUSION, HANGING DROP, temperature 278K, pH 6.80	Resolution 2.10 Å R-free 0.278
3MUS 2A Resolution Structure of Rat Type B Cytochrome b5 Deposited 2010-05-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–102（86 aa） Fragment：UNP residues 17-102	Not recorded	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；30%PEG8K, 0.2M MgAc, 0.1M Hepes, pH 6.8, EVAPORATION, temperature 277K	Resolution 2.00 Å R-free 0.223
3MUS 2A Resolution Structure of Rat Type B Cytochrome b5 Deposited 2010-05-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 17–102（86 aa） Fragment：UNP residues 17-102	Not recorded	HEM PROTOPORPHYRIN IX CONTAINING FE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；30%PEG8K, 0.2M MgAc, 0.1M Hepes, pH 6.8, EVAPORATION, temperature 277K	Resolution 2.00 Å R-free 0.223

7 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CYB5B_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–86； UniProt 17–102 Author chain B； PDBConstruct 1–86； UniProt 17–102

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4hil
Deposition date deposition_date	2012-10-11
Structure title title	1.25A Resolution Structure of Rat Type B Cytochrome b5
Keywords keywords	CYTOCHROME B5, HEME, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	17.41 Å
Radius of gyration Rg (electron density) rg_electron	16.42 Å
Forward intensity I(0) i0	7641330.00
Molecular weight molecular_weight	20045.0 kDa
Excluded volume excluded_volume	24886 Å³
Envelope volume envelope_volume	28232 Å³
Hydration-shell volume shell_volume	14832 Å³
Envelope diameter envelope_diameter	55.4 Å
Shell Rg shell_rg	21.86 Å
Envelope Rg envelope_rg	16.50 Å
Shape Rg shape_rg	16.41 Å
Total Rg total_rg	17.40 Å
Total atoms total_atoms	1415
Residues n_residues	166
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	54.8 Å
Rg (real space) rg_real	17.34 Å
Rg uncertainty (real space) rg_real_error	0.35 Å
I(0) (real space) i0_real	7.6410e+06
I(0) uncertainty (real space) i0_real_error	8.0340e+04
Rg (reciprocal space) rg_reciprocal	17.35 Å
I(0) (reciprocal space) i0_reciprocal	7641000.0000
Solution quality estimate total_estimate	0.8185
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	21.2 Å
Skewness Skewness skewness	0.232
Kurtosis Kurtosis kurtosis	-0.395
Angular range angular_range	— – 0.4550 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2011000.0000
Real-space data points n_real_points	76
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.880; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Cytochrome b5 type B
Molecular weight formula_weight	9888.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1758

DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPA

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	brown rat,rat,rats
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	233

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4hila_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.120 — Cytochrome b5-like heme/steroid binding domain
Superfamily Superfamily superfamily	d.120.1 — Cytochrome b5-like heme/steroid binding domain
Family Family family	d.120.1.1 — Cytochrome b5

Domain ID domain_id	d4hilb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.120 — Cytochrome b5-like heme/steroid binding domain
Superfamily Superfamily superfamily	d.120.1 — Cytochrome b5-like heme/steroid binding domain
Family Family family	d.120.1.1 — Cytochrome b5

CATH v4.4 (2 domains)

Domain ID domain_id	4hilA00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	120 — Flavocytochrome B2; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Cytochrome b5-like heme/steroid binding domain

Domain ID domain_id	4hilB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	120 — Flavocytochrome B2; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Cytochrome b5-like heme/steroid binding domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	38.609 Å
Unit-cell length b length_b	67.847 Å
Unit-cell length c length_c	70.342 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.250 Å
Low-resolution limit resolution_low	35.171 Å
R factor r_factor	0.1379
R_work r_work	0.1371
R_free r_free	0.1522

fit	/app/data/saxs_computation/hi/4hil/4hil.fit
pddf	/app/data/pr_computation/hi/4hil/4hil.pr.out
profile	/app/data/saxs_computation/hi/4hil/4hil.dat

1.25A Resolution Structure of Rat Type B Cytochrome b5

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b5 type B

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction