SAXSdb — 4ne5

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere protein S

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Centromere protein X × 2 （A8MT69） water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Centromere protein X × 2 （A8MT69） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPS_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–92； UniProt 14–105 Author chain C； PDBConstruct 1–92； UniProt 14–105 Author chain E； PDBConstruct 1–92； UniProt 14–105 Author chain G； PDBConstruct 1–92； UniProt 14–105

Centromere protein X

Homo sapiens

UniProt A8MT69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Centromere protein S × 2 （Q8N2Z9） water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Centromere protein S × 2 （Q8N2Z9） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPX_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–74； UniProt 8–81 Author chain D； PDBConstruct 1–74； UniProt 8–81 Author chain F； PDBConstruct 1–74； UniProt 8–81 Author chain H； PDBConstruct 1–74； UniProt 8–81

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ne5
Deposition date deposition_date	2013-10-28
Structure title title	Human MHF1-MHF2 complex
Keywords keywords	Histone fold, DNA repair, genome maintenance, Fanconi Anemia, FancM, Nucleus, DNA Binding Protein; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4ne5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4ne5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4ne5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.71 Å
Rg (electron density)	21.61 Å
Total Rg	22.48 Å
Atom count	2666
Residues	328
Excluded volume	47950 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4ne5__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4ne5__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Centromere protein S
Molecular weight formula_weight	10740.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	5479

SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Centromere protein X
Molecular weight formula_weight	8445.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	147

▼

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	4ne5A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4ne5B01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4ne5B02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4ne5C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4ne5D01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4ne5D02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4ne5E00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4ne5F01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4ne5F02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4ne5G00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4ne5H01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	4980 —

Domain ID domain_id	4ne5H02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	130 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	41.076 Å
Unit-cell length b length_b	128.760 Å
Unit-cell length c length_c	88.836 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.96 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	38.510 Å
R factor r_factor	0.2312
R_work r_work	0.2295
R_free r_free	0.2636

Human MHF1-MHF2 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere protein S

State in the Current Structure

Other States of the Same Protein in the Database

Centromere protein X

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ne5__assembly_1__model_1

4ne5__assembly_1__model_1 | I(q)

4ne5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)

Human MHF1-MHF2 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere protein S

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein X

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ne5__assembly_1__model_1

4ne5__assembly_1__model_1 | I(q)

4ne5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)