SAXSdb — 4qrm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein FliM

Thermotoga maritima

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
10	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain M； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
11	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain O； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain I； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain Q； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
7	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain S； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
8	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain U； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
9	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 46–228	Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4QRM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2HP7 Structure of FliM provides insight into assembly of the switch complex in the bacterial flagella motor Deposited 2006-07-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 44–226（183 aa） Fragment：CheC-like domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；30-40% PEG 4K, 0.1M TrisHCL pH 8.5, 0.2 M sodium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 298K X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.8 M Na K tartrate, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.249
3SOH Architecture of the Flagellar Rotor Deposited 2011-06-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 46–233（188 aa） Fragment：N-terminal domain (UNP residues 46-233)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
3SOH Architecture of the Flagellar Rotor Deposited 2011-06-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 46–233（188 aa） Fragment：N-terminal domain (UNP residues 46-233)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
4FHR Crystal structure of the complex between the flagellar motor proteins FliG and FliM. Deposited 2012-06-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–230（185 aa） Fragment：Middle domain, UNP residues 46-230	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；50 mM calcium acetate, 0.1 M sodium cacodylate pH 6.0, and 25% v/v MPD, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.243
4IGA The crystal structure of an activated Thermotoga maritima CheY with N-terminal region of FliM Deposited 2012-12-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–20（20 aa） Fragment：UNP RESIDUES 1-20	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；30% (w/v) PEG 4000, 0.1M TRIS pH 8.5, 0.2M sodium acetate, 0.2M lithium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.73 Å R-free 0.276

4 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIM_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–183； UniProt 46–228 Author chain C； PDBConstruct 1–183； UniProt 46–228 Author chain E； PDBConstruct 1–183； UniProt 46–228 Author chain G； PDBConstruct 1–183； UniProt 46–228 Author chain I； PDBConstruct 1–183； UniProt 46–228 Author chain K； PDBConstruct 1–183； UniProt 46–228 Author chain M； PDBConstruct 1–183； UniProt 46–228 Author chain O； PDBConstruct 1–183； UniProt 46–228 Author chain Q； PDBConstruct 1–183； UniProt 46–228 Author chain S； PDBConstruct 1–183； UniProt 46–228 Author chain U； PDBConstruct 1–183； UniProt 46–228

Flagellar motor switch protein FliG

Thermotoga maritima

UniProt Q9WY63

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
10	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain N； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
11	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain P； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain H； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain J； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain R； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
7	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain T； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
8	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain V； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
9	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 117–187	Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4QRM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1LKV Crystal Structure of the Middle and C-terminal Domains of the Flagellar Rotor Protein FliG Deposited 2002-04-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 104–335（232 aa） Fragment：RESIDUES 104-335	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；Isopropanol, CaCl2, sodium acetate, pluronic F-68, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.280
1LKV Crystal Structure of the Middle and C-terminal Domains of the Flagellar Rotor Protein FliG Deposited 2002-04-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain X 104–335（232 aa） Fragment：RESIDUES 104-335	Not recorded	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；Isopropanol, CaCl2, sodium acetate, pluronic F-68, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.280
1QC7 T. MARITIMA FLIG C-TERMINAL DOMAIN Deposited 1999-05-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 235–335（101 aa） Fragment：FLIG-C Chain B 235–335（101 aa） Fragment：FLIG-C	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.2；286 K；ISOPROPANOL, pH 5.2, temperature 286K	Resolution 2.20 Å R-free 0.304
3AJC Structure of the MC domain of FliG (PEV), a CW-biased mutant Deposited 2010-05-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 104–335（232 aa） Fragment：FliG MC domain, UNP residues 104-335	Mutation：deletion of UNP residues 170-172	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；277 K；50% PEG 200, 0.1M Phospho-Citrate, 0.2M NaCl, pH 4.2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
3SOH Architecture of the Flagellar Rotor Deposited 2011-06-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 117–193（77 aa） Fragment：middle domain (UNP residues 117-193)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
3SOH Architecture of the Flagellar Rotor Deposited 2011-06-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 117–193（77 aa） Fragment：middle domain (UNP residues 117-193)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
4FHR Crystal structure of the complex between the flagellar motor proteins FliG and FliM. Deposited 2012-06-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 115–327（213 aa） Fragment：Middle and C-terminal domains. UNP residues 115-327	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；50 mM calcium acetate, 0.1 M sodium cacodylate pH 6.0, and 25% v/v MPD, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.243
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–98（98 aa） Chain D 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–98（98 aa） Chain D 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217

6 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIG_THEMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 5–75； UniProt 117–187 Author chain D； PDBConstruct 5–75； UniProt 117–187 Author chain F； PDBConstruct 5–75； UniProt 117–187 Author chain H； PDBConstruct 5–75； UniProt 117–187 Author chain J； PDBConstruct 5–75； UniProt 117–187 Author chain L； PDBConstruct 5–75； UniProt 117–187 Author chain N； PDBConstruct 5–75； UniProt 117–187 Author chain P； PDBConstruct 5–75； UniProt 117–187 Author chain R； PDBConstruct 5–75； UniProt 117–187 Author chain T； PDBConstruct 5–75； UniProt 117–187 Author chain V； PDBConstruct 5–75； UniProt 117–187

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4qrm
Deposition date deposition_date	2014-07-01
Structure title title	crystal structure of a binary complex of FliM-FliG middle domains from T.maritima
Keywords keywords	Flagellar rotor proteins, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	57.83 Å
Radius of gyration Rg (electron density) rg_electron	57.81 Å
Forward intensity I(0) i0	1318830000.00
Molecular weight molecular_weight	322920.0 kDa
Excluded volume excluded_volume	411710 Å³
Envelope volume envelope_volume	620420 Å³
Hydration-shell volume shell_volume	92558 Å³
Envelope diameter envelope_diameter	214.0 Å
Shell Rg shell_rg	56.91 Å
Envelope Rg envelope_rg	56.51 Å
Shape Rg shape_rg	57.80 Å
Total Rg total_rg	57.82 Å
Total atoms total_atoms	22777
Residues n_residues	2837
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	193.8 Å
Rg (real space) rg_real	57.79 Å
Rg uncertainty (real space) rg_real_error	1.56 Å
I(0) (real space) i0_real	1.3190e+09
I(0) uncertainty (real space) i0_real_error	2.3580e+07
Rg (reciprocal space) rg_reciprocal	57.84 Å
I(0) (reciprocal space) i0_reciprocal	1319000000.0000
Solution quality estimate total_estimate	0.8558
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	79.0 Å
Skewness Skewness skewness	0.285
Kurtosis Kurtosis kurtosis	-0.179
Angular range angular_range	— – 0.1350 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	59860000.0000
Real-space data points n_real_points	28
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.813; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.681

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Flagellar motor switch protein FliM
Molecular weight formula_weight	21060.2 kDa
Source method src_method	man
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O,Q,S,U
Atom count atom_count	22777

KFSKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEISIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPPNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVETNPQFVQIVPPNEIVLLVTASVSWGEFTSFINVCWPFSLLEPLLEKLS

来源 Source

来源生物 organism	Thermotoga maritima
NCBI Class编号 ncbi_taxonomy_id	243274
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar motor switch protein FliG
Molecular weight formula_weight	8371.7 kDa
Source method src_method	man
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P,R,T,V

GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGF

来源 Source

来源生物 organism	Thermotoga maritima
NCBI Class编号 ncbi_taxonomy_id	243274
宿主生物 host_organism	Escherichia coli

▶

8. Citations (1)

▶

Unit-cell length a length_a	105.403 Å
Unit-cell length b length_b	216.255 Å
Unit-cell length c length_c	262.214 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	44

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	4.315 Å
Low-resolution limit resolution_low	44.180 Å
R factor r_factor	0.2128
R_work r_work	0.2087
R_free r_free	0.2908

fit	/app/data/saxs_computation/qr/4qrm/4qrm.fit
pddf	/app/data/pr_computation/qr/4qrm/4qrm.pr.out
profile	/app/data/saxs_computation/qr/4qrm/4qrm.dat

crystal structure of a binary complex of FliM-FliG middle domains from T.maritima

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein FliM

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar motor switch protein FliG

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)