4r7z

PfMCM-AAA double-octamer

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cell division control protein 21

Pyrococcus furiosus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 16	ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U3I4_PYRFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–91； UniProt 262–352 Author chain A； PDBConstruct 125–338； UniProt 753–966 Author chain B； PDBConstruct 1–91； UniProt 262–352 Author chain B； PDBConstruct 125–338； UniProt 753–966 Author chain C； PDBConstruct 1–91； UniProt 262–352 Author chain C； PDBConstruct 125–338； UniProt 753–966 Author chain D； PDBConstruct 1–91； UniProt 262–352 Author chain D； PDBConstruct 125–338； UniProt 753–966 Author chain E； PDBConstruct 1–91； UniProt 262–352 Author chain E； PDBConstruct 125–338； UniProt 753–966 Author chain F； PDBConstruct 1–91； UniProt 262–352 Author chain F； PDBConstruct 125–338； UniProt 753–966 Author chain G； PDBConstruct 1–91； UniProt 262–352 Author chain G； PDBConstruct 125–338； UniProt 753–966 Author chain H； PDBConstruct 1–91； UniProt 262–352 Author chain H； PDBConstruct 125–338； UniProt 753–966 Author chain I； PDBConstruct 1–91； UniProt 262–352 Author chain I； PDBConstruct 125–338； UniProt 753–966 Author chain J； PDBConstruct 1–91； UniProt 262–352 Author chain J； PDBConstruct 125–338； UniProt 753–966 Author chain K； PDBConstruct 1–91； UniProt 262–352 Author chain K； PDBConstruct 125–338； UniProt 753–966 Author chain L； PDBConstruct 1–91； UniProt 262–352 Author chain L； PDBConstruct 125–338； UniProt 753–966 Author chain M； PDBConstruct 1–91； UniProt 262–352 Author chain M； PDBConstruct 125–338； UniProt 753–966 Author chain N； PDBConstruct 1–91； UniProt 262–352 Author chain N； PDBConstruct 125–338； UniProt 753–966 Author chain O； PDBConstruct 1–91； UniProt 262–352 Author chain O； PDBConstruct 125–338； UniProt 753–966 Author chain P； PDBConstruct 1–91； UniProt 262–352 Author chain P； PDBConstruct 125–338； UniProt 753–966

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4r7z
Deposition date deposition_date	2014-08-28
Structure title title	PfMCM-AAA double-octamer
Keywords keywords	AAA+, MCM, helicase, ATPase, DNA replication, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4r7z__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4r7z__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4r7z__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.15 Å
Rg (electron density)	59.75 Å
Total Rg	60.03 Å
Atom count	39296
Residues	5056
Excluded volume	701260 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4r7z__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Cell division control protein 21
Molecular weight formula_weight	37185.4 kDa
Source method src_method	man
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P
Atom count atom_count	39296

SPEEEQIIKELAKRKDIVDAIVDSIAPAIYGYKEVKKGIALALFGGVSRKLPDGTRLRGDIHVLLVGDPGVAKSQILRYVANLAPRAIYTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGYALIDELDKMSDRDRSVIHEALEQQTISISKAGITATLNARTTVIAAANPKQGRFNRMKNPFEQIDLPPTLLSRFDLIFVLIDEPDDKIDSEVARHILRVRRGESEVVAPKIPHEILRKYIAYARKNIHPVISEEAMEEIEKYYVRMRKSVKKTKGEEEGIPPIPITARQLEALIRLSEAHARMRLSPIVTREDAREAIKLMEYTLKQIAMD

Source Source

Source organism organism	Pyrococcus furiosus
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	16

▼

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

Domain ID domain_id	4r7zA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zE00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zG00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zH00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zI00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zJ00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zK00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zL00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zM00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zN00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zO00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4r7zP00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

Unit-cell length a length_a	124.956 Å
Unit-cell length b length_b	127.082 Å
Unit-cell length c length_c	128.025 Å
Unit-cell angle α angle_alpha	71.85 °
Unit-cell angle β angle_beta	72.82 °
Unit-cell angle γ angle_gamma	80.39 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	48.370 Å
R factor r_factor	0.3010
R_work r_work	0.3010
R_free r_free	0.3140

PfMCM-AAA double-octamer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cell division control protein 21

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4r7z__assembly_1__model_1

4r7z__assembly_1__model_1 | I(q)

4r7z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)

PfMCM-AAA double-octamer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cell division control protein 21

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4r7z__assembly_1__model_1

4r7z__assembly_1__model_1 | I(q)

4r7z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)