4uow

Crystal structure of the titin M10-Obscurin Ig domain 1 complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Titin

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） SODIUM ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9） CHLORIDE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 2	Obscurin × 1 （Q5VST9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TITIN_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–97； UniProt 34253–34349 Author chain 2； PDBConstruct 1–97； UniProt 34253–34349 Author chain 4； PDBConstruct 1–97； UniProt 34253–34349 Author chain 6； PDBConstruct 1–97； UniProt 34253–34349 Author chain 8； PDBConstruct 1–97； UniProt 34253–34349 Author chain A； PDBConstruct 1–97； UniProt 34253–34349 Author chain C； PDBConstruct 1–97； UniProt 34253–34349 Author chain E； PDBConstruct 1–97； UniProt 34253–34349 Author chain G； PDBConstruct 1–97； UniProt 34253–34349 Author chain I； PDBConstruct 1–97； UniProt 34253–34349 Author chain K； PDBConstruct 1–97； UniProt 34253–34349 Author chain M； PDBConstruct 1–97； UniProt 34253–34349 Author chain O； PDBConstruct 1–97； UniProt 34253–34349 Author chain Q； PDBConstruct 1–97； UniProt 34253–34349 Author chain S； PDBConstruct 1–97； UniProt 34253–34349 Author chain U； PDBConstruct 1–97； UniProt 34253–34349 Author chain W； PDBConstruct 1–97； UniProt 34253–34349 Author chain Y； PDBConstruct 1–97； UniProt 34253–34349

Obscurin

Homo sapiens

UniProt Q5VST9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） SODIUM ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42） CHLORIDE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 2	Titin × 1 （Q8WZ42）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OBSCN_HUMAN
Isoform	Q5VST9-6
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 3–92； UniProt 10–99 Author chain 3； PDBConstruct 3–92； UniProt 10–99 Author chain 5； PDBConstruct 3–92； UniProt 10–99 Author chain 7； PDBConstruct 3–92； UniProt 10–99 Author chain 9； PDBConstruct 3–92； UniProt 10–99 Author chain B； PDBConstruct 3–92； UniProt 10–99 Author chain D； PDBConstruct 3–92； UniProt 10–99 Author chain F； PDBConstruct 3–92； UniProt 10–99 Author chain H； PDBConstruct 3–92； UniProt 10–99 Author chain J； PDBConstruct 3–92； UniProt 10–99 Author chain L； PDBConstruct 3–92； UniProt 10–99 Author chain N； PDBConstruct 3–92； UniProt 10–99 Author chain P； PDBConstruct 3–92； UniProt 10–99 Author chain R； PDBConstruct 3–92； UniProt 10–99 Author chain T； PDBConstruct 3–92； UniProt 10–99 Author chain V； PDBConstruct 3–92； UniProt 10–99 Author chain X； PDBConstruct 3–92； UniProt 10–99 Author chain Z； PDBConstruct 3–92； UniProt 10–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4uow
Deposition date deposition_date	2014-06-10
Structure title title	Crystal structure of the titin M10-Obscurin Ig domain 1 complex
Keywords keywords	TRANSFERASE-STRUCTURAL PROTEIN COMPLEX, TRANSFERASE, SARCOMERE, IMMUNOGLOBULIN DOMAIN, LIMB-GIRDLE MUSCULAR DYSTROPHY; TRANSFERASE/STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4uow__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4uow__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4uow__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.03 Å
Rg (electron density)	16.87 Å
Total Rg	17.85 Å
Atom count	1433
Residues	190
Excluded volume	25378 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4uow__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4uow__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4uow__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4uow__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4uow__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4uow__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4uow__assembly_7__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4uow__assembly_8__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`4uow__assembly_9__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`4uow__assembly_10__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`4uow__assembly_11__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`4uow__assembly_12__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
13	1	`4uow__assembly_13__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
14	1	`4uow__assembly_14__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
15	1	`4uow__assembly_15__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
16	1	`4uow__assembly_16__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
17	1	`4uow__assembly_17__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
18	1	`4uow__assembly_18__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Titin
Molecular weight formula_weight	10479.7 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,2,4,6,8,A,C,E,G,I,K,M,O,Q,S,U,W,Y
Atom count atom_count	25793

GIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	Obscurin
Molecular weight formula_weight	9930.3 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,3,5,7,9,B,D,F,H,J,L,N,P,R,T,V,X,Z

SSAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQDGDLYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLQV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

Domain ID domain_id	4uow000
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow100
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow200
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow300
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow400
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow500
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow600
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow700
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow800
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uow900
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowG00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowH00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowI00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowJ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowK00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowL00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowM00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowN00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowO00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowP00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowQ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowR00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowT00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowU00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowV00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowW00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowX00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowY00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4uowZ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	201.560 Å
Unit-cell length b length_b	201.560 Å
Unit-cell length c length_c	183.960 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	108

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	39.430 Å
R factor r_factor	0.1787
R_work r_work	0.1770
R_free r_free	0.2097

Crystal structure of the titin M10-Obscurin Ig domain 1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Titin

State in the Current Structure

Other States of the Same Protein in the Database

Obscurin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uow__assembly_1__model_1

4uow__assembly_1__model_1 | I(q)

4uow__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

7. Citations (1)

Crystal structure of the titin M10-Obscurin Ig domain 1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Titin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Obscurin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uow__assembly_1__model_1

4uow__assembly_1__model_1 | I(q)

4uow__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

7. Citations (1)