4v8k

Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 5 PHOSPHATE ION × 3 water × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 PHOSPHATE ION × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P5_THETI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AC； PDBConstruct 1–404； UniProt 1–404 Author chain BC； PDBConstruct 1–404； UniProt 1–404

Photosynthetic reaction center L subunit

OrganismNot specified

UniProt D2Z0P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 5 PHOSPHATE ION × 3 water × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 PHOSPHATE ION × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P3_THETI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AL； PDBConstruct 1–281； UniProt 1–281 Author chain BL； PDBConstruct 1–281； UniProt 1–281

Photosynthetic reaction center M subunit

OrganismNot specified

UniProt A8ASG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 5 PHOSPHATE ION × 3 water × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 PHOSPHATE ION × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8ASG6_THETI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AM； PDBConstruct 1–325； UniProt 1–325 Author chain BM； PDBConstruct 1–325； UniProt 1–325

Photosynthetic reaction center H subunit

OrganismNot specified

UniProt D2Z0P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 5 PHOSPHATE ION × 3 water × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 PHOSPHATE ION × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P9_THETI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AH； PDBConstruct 1–259； UniProt 1–259 Author chain BH； PDBConstruct 1–259； UniProt 1–259

LH1 alpha polypeptide

OrganismNot specified

UniProt D2Z0P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 5 PHOSPHATE ION × 3 water × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 PHOSPHATE ION × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P2_THETI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A1； PDBConstruct 1–61； UniProt 1–61 Author chain A3； PDBConstruct 1–61； UniProt 1–61 Author chain A5； PDBConstruct 1–61； UniProt 1–61 Author chain A7； PDBConstruct 1–61； UniProt 1–61 Author chain A9； PDBConstruct 1–61； UniProt 1–61 Author chain AA； PDBConstruct 1–61； UniProt 1–61 Author chain AD； PDBConstruct 1–61； UniProt 1–61 Author chain AF； PDBConstruct 1–61； UniProt 1–61 Author chain AI； PDBConstruct 1–61； UniProt 1–61 Author chain AK； PDBConstruct 1–61； UniProt 1–61 Author chain AO； PDBConstruct 1–61； UniProt 1–61 Author chain AQ； PDBConstruct 1–61； UniProt 1–61 Author chain AS； PDBConstruct 1–61； UniProt 1–61 Author chain AU； PDBConstruct 1–61； UniProt 1–61 Author chain AW； PDBConstruct 1–61； UniProt 1–61 Author chain AY； PDBConstruct 1–61； UniProt 1–61 Author chain B1； PDBConstruct 1–61； UniProt 1–61 Author chain B3； PDBConstruct 1–61； UniProt 1–61 Author chain B5； PDBConstruct 1–61； UniProt 1–61 Author chain B7； PDBConstruct 1–61； UniProt 1–61 Author chain B9； PDBConstruct 1–61； UniProt 1–61 Author chain BA； PDBConstruct 1–61； UniProt 1–61 Author chain BD； PDBConstruct 1–61； UniProt 1–61 Author chain BF； PDBConstruct 1–61； UniProt 1–61 Author chain BI； PDBConstruct 1–61； UniProt 1–61 Author chain BK； PDBConstruct 1–61； UniProt 1–61 Author chain BO； PDBConstruct 1–61； UniProt 1–61 Author chain BQ； PDBConstruct 1–61； UniProt 1–61 Author chain BS； PDBConstruct 1–61； UniProt 1–61 Author chain BU； PDBConstruct 1–61； UniProt 1–61 Author chain BW； PDBConstruct 1–61； UniProt 1–61 Author chain BY； PDBConstruct 1–61； UniProt 1–61

LH1 beta polypeptide

OrganismNot specified

UniProt D2Z0P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 5 PHOSPHATE ION × 3 water × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 17 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 PHOSPHATE ION × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P1_THETI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A0； PDBConstruct 1–47； UniProt 1–47 Author chain A2； PDBConstruct 1–47； UniProt 1–47 Author chain A4； PDBConstruct 1–47； UniProt 1–47 Author chain A6； PDBConstruct 1–47； UniProt 1–47 Author chain A8； PDBConstruct 1–47； UniProt 1–47 Author chain AB； PDBConstruct 1–47； UniProt 1–47 Author chain AE； PDBConstruct 1–47； UniProt 1–47 Author chain AG； PDBConstruct 1–47； UniProt 1–47 Author chain AJ； PDBConstruct 1–47； UniProt 1–47 Author chain AN； PDBConstruct 1–47； UniProt 1–47 Author chain AP； PDBConstruct 1–47； UniProt 1–47 Author chain AR； PDBConstruct 1–47； UniProt 1–47 Author chain AT； PDBConstruct 1–47； UniProt 1–47 Author chain AV； PDBConstruct 1–47； UniProt 1–47 Author chain AX； PDBConstruct 1–47； UniProt 1–47 Author chain AZ； PDBConstruct 1–47； UniProt 1–47 Author chain B0； PDBConstruct 1–47； UniProt 1–47 Author chain B2； PDBConstruct 1–47； UniProt 1–47 Author chain B4； PDBConstruct 1–47； UniProt 1–47 Author chain B6； PDBConstruct 1–47； UniProt 1–47 Author chain B8； PDBConstruct 1–47； UniProt 1–47 Author chain BB； PDBConstruct 1–47； UniProt 1–47 Author chain BE； PDBConstruct 1–47； UniProt 1–47 Author chain BG； PDBConstruct 1–47； UniProt 1–47 Author chain BJ； PDBConstruct 1–47； UniProt 1–47 Author chain BN； PDBConstruct 1–47； UniProt 1–47 Author chain BP； PDBConstruct 1–47； UniProt 1–47 Author chain BR； PDBConstruct 1–47； UniProt 1–47 Author chain BT； PDBConstruct 1–47； UniProt 1–47 Author chain BV； PDBConstruct 1–47； UniProt 1–47 Author chain BX； PDBConstruct 1–47； UniProt 1–47 Author chain BZ； PDBConstruct 1–47； UniProt 1–47

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v8k
Deposition date deposition_date	2013-11-22
Structure title title	Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form
Keywords keywords	photosynthesis; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v8k__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v8k__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v8k__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.69 Å
Rg (electron density)	43.83 Å
Total Rg	44.36 Å
Atom count	25272
Residues	2697
Excluded volume	470040 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v8k__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4v8k__assembly_2__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Photosynthetic reaction center cytochrome c subunit
Molecular weight formula_weight	43177.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,BC
Atom count atom_count	50862

MSPAQQLTLPAVIVVASVMLLGCEGPPPGTEQIGYRGVGMENYYNKRQRALSIQANQPVESLPAADSTGPKASEVYQNVQVLKDLSVGEFTRTMVAVTTWVSPKEGCNYCHVPGNWASDDIYTKVVSRRMFELVRAANSDWKAHVAETGVTCYTCHRGNPVPKYAWVTDPGPKYPSGLKPTGQNYGSKTVAYASLPFDPLTPFLDQANEIRITGNAALAGSNPASLKQAEWTFGLMMNISDSLGVGCTFCHNTRAFNDWTQSTPKRTTAWYAIRHVRDINQNYIWPLNDVLPASRKGPYGDPLRVSCMTCHQAVNKPLYGAQMAKDYPGLYKTAVTQEALAGSAPASEAAPAAATEAAPEAPAQEVPAAEAVPAAAEPGAAEAAGSVEPAPVEEVAPAPAAQRL

Entity 2 Entity 2 polymer

Description description	Photosynthetic reaction center L subunit
Molecular weight formula_weight	31520.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL,BL

MAMLSFEKKYRVRGGTLIGGDLFDFWVGPFYVGFFGVVGFCFTLLGVLLIVWGATIGPTGPTSDLQTYNLWRISIAPPDLSYGLRMAPLTEGGLWQIITICAAGAFISWALREVEICRKLGIGFHVPFAFSFAIGAYLVLVFVRPLLMGAWGHGFPYGILSHLDWVSNVGYQFLHFHYNPAHMLAISFFFTNCLALSMHGSLILSVTNPQKGEPVKTSEHENTFFRDIVGYSIGALAIHRLGLFLALSAAFWSAVCILISGPFWTRGWPEWWNWWLELPLW

Entity 3 Entity 3 polymer

Description description	Photosynthetic reaction center M subunit
Molecular weight formula_weight	36605.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM,BM

MPEYQNIFTAVQVRAPAYPGVPLPKGNLPRIGRPIFSYWLGKIGDAQIGPIYLGLTGTLSIFFGLVAISIIGFNMLASVHWDVFQFLKHFFWLGLEPPPPQYGLRIPPLSEGGWWLMAGLFLTLSILLWWVRTYKRAEALGMSQHLSWAFAAAIFFYLVLGFIRPVMMGSWAKAVPFGIFPHLDWTAAFSIRYGNLYYNPFHMLSIAFLYGSALLFAMHGATILSVSRFGGDREIDQITHRGTAAERAALFWRWTMGFNVTMESIHRWAWWCAVLTVITAGIGILLSGTVVDNWYLWAVKHGMAPAYPEVVTAVNPYETAAEVMQ

Entity 4 Entity 4 polymer

Description description	Photosynthetic reaction center H subunit
Molecular weight formula_weight	28213.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH,BH

MSAGITHYIDAAQITIWAFWLFFFGLIIYLRREDKREGYPLDSDRTERSGGRVKVVGFPDLPDPKTFVLPHNGGTVVAPRVEAPVAVNATPFSPAPGSPLVPNGDPMLSGFGPAASPDRPKHCDLTFEGLPKIVPMRVAKEFSIAEGDPDPRGMTVVGLDGEVAGTVSDVWVDRSEPQIRYLEVEVAANKKKVLLPIGFSRFDKKARKVKVDAIKAAHFANVPTLSNPDQVTLYEEDKVCAYYAGGKLYATAERAGPLL

Entity 5 Entity 5 polymer

Description description	LH1 alpha polypeptide
Molecular weight formula_weight	7034.4 kDa
Source method src_method	nat
Copy count entity_count	32

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AD,AF,AI,AK,AO,AQ,AS,AU,AW,AY,A1,A3,A5,A7,A9,BA,BD,BF,BI,BK,BO,BQ,BS,BU,BW,BY,B1,B3,B5,B7,B9

MFTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPVSYQALGKK

Entity 6 Entity 6 polymer

Description description	LH1 beta polypeptide
Molecular weight formula_weight	5534.5 kDa
Source method src_method	nat
Copy count entity_count	32

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,AE,AG,AJ,AN,AP,AR,AT,AV,AX,AZ,A2,A4,A6,A8,A0,BB,BE,BG,BJ,BN,BP,BR,BT,BV,BX,BZ,B2,B4,B6,B8,B0

MAEQKSLTGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL

Entity 7 Entity 7 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 8 Entity 8 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	34

Entity 9 Entity 9 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	72

Entity 10 Entity 10 non-polymer

Description description	BACTERIOPHEOPHYTIN A
Molecular weight formula_weight	889.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 11 Entity 11 non-polymer

Description description	Ubiquinone-8
Molecular weight formula_weight	727.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 non-polymer

Description description	MENAQUINONE 8
Molecular weight formula_weight	717.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	SPIRILLOXANTHIN
Molecular weight formula_weight	596.9 kDa
Source method src_method	syn
Copy count entity_count	34

Entity 15 Entity 15 non-polymer

Description description	DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 16 Entity 16 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	21

▶

Unit-cell length a length_a	167.159 Å
Unit-cell length b length_b	145.429 Å
Unit-cell length c length_c	210.528 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.50 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	64

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.006 Å
Low-resolution limit resolution_low	43.794 Å
R factor r_factor	0.3364
R_work r_work	0.3354
R_free r_free	0.3564

Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center L subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center M subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center H subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LH1 alpha polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LH1 beta polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v8k__assembly_2__model_1

4v8k__assembly_2__model_1 | I(q)

4v8k__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 non-polymer

Entity 13 Entity 13 non-polymer