7c52

Co-crystal structure of a photosynthetic LH1-RC in complex with electron donor HiPIP

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 37	Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） High-potential iron-sulfur protein × 1 （P80176） HEME C × 4 CALCIUM ION × 17 GLYCEROL × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 10 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 5 SULFATE ION × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 CARDIOLIPIN × 10 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 DODECYL-BETA-D-MALTOSIDE × 2 IRON/SULFUR CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYCR_THETI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–311； UniProt 23–333

Photosynthetic reaction center L subunit

OrganismNot specified

UniProt D2Z0P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 37	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） High-potential iron-sulfur protein × 1 （P80176） HEME C × 4 CALCIUM ION × 17 GLYCEROL × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 10 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 5 SULFATE ION × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 CARDIOLIPIN × 10 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 DODECYL-BETA-D-MALTOSIDE × 2 IRON/SULFUR CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P3_THETI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–281； UniProt 1–281

Photosynthetic reaction center M subunit

OrganismNot specified

UniProt A8ASG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 37	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） High-potential iron-sulfur protein × 1 （P80176） HEME C × 4 CALCIUM ION × 17 GLYCEROL × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 10 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 5 SULFATE ION × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 CARDIOLIPIN × 10 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 DODECYL-BETA-D-MALTOSIDE × 2 IRON/SULFUR CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8ASG6_THETI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–325； UniProt 1–325

Photosynthetic reaction center H subunit

OrganismNot specified

UniProt D2Z0P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 37	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） High-potential iron-sulfur protein × 1 （P80176） HEME C × 4 CALCIUM ION × 17 GLYCEROL × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 10 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 5 SULFATE ION × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 CARDIOLIPIN × 10 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 DODECYL-BETA-D-MALTOSIDE × 2 IRON/SULFUR CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P9_THETI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–259； UniProt 1–259

LH1 alpha polypeptide

OrganismNot specified

UniProt D2Z0P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 37	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 beta polypeptide × 16 （D2Z0P1） High-potential iron-sulfur protein × 1 （P80176） HEME C × 4 CALCIUM ION × 17 GLYCEROL × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 10 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 5 SULFATE ION × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 CARDIOLIPIN × 10 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 DODECYL-BETA-D-MALTOSIDE × 2 IRON/SULFUR CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P2_THETI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 1； PDBConstruct 1–61； UniProt 1–61 Author chain 3； PDBConstruct 1–61； UniProt 1–61 Author chain 5； PDBConstruct 1–61； UniProt 1–61 Author chain 7； PDBConstruct 1–61； UniProt 1–61 Author chain 9； PDBConstruct 1–61； UniProt 1–61 Author chain A； PDBConstruct 1–61； UniProt 1–61 Author chain D； PDBConstruct 1–61； UniProt 1–61 Author chain F； PDBConstruct 1–61； UniProt 1–61 Author chain I； PDBConstruct 1–61； UniProt 1–61 Author chain K； PDBConstruct 1–61； UniProt 1–61 Author chain O； PDBConstruct 1–61； UniProt 1–61 Author chain Q； PDBConstruct 1–61； UniProt 1–61 Author chain S； PDBConstruct 1–61； UniProt 1–61 Author chain U； PDBConstruct 1–61； UniProt 1–61 Author chain W； PDBConstruct 1–61； UniProt 1–61 Author chain Y； PDBConstruct 1–61； UniProt 1–61

LH1 beta polypeptide

OrganismNot specified

UniProt D2Z0P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 37	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） High-potential iron-sulfur protein × 1 （P80176） HEME C × 4 CALCIUM ION × 17 GLYCEROL × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 10 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 5 SULFATE ION × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 CARDIOLIPIN × 10 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 DODECYL-BETA-D-MALTOSIDE × 2 IRON/SULFUR CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P1_THETI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 0； PDBConstruct 1–47； UniProt 1–47 Author chain 2； PDBConstruct 1–47； UniProt 1–47 Author chain 4； PDBConstruct 1–47； UniProt 1–47 Author chain 6； PDBConstruct 1–47； UniProt 1–47 Author chain 8； PDBConstruct 1–47； UniProt 1–47 Author chain B； PDBConstruct 1–47； UniProt 1–47 Author chain E； PDBConstruct 1–47； UniProt 1–47 Author chain G； PDBConstruct 1–47； UniProt 1–47 Author chain J； PDBConstruct 1–47； UniProt 1–47 Author chain N； PDBConstruct 1–47； UniProt 1–47 Author chain P； PDBConstruct 1–47； UniProt 1–47 Author chain R； PDBConstruct 1–47； UniProt 1–47 Author chain T； PDBConstruct 1–47； UniProt 1–47 Author chain V； PDBConstruct 1–47； UniProt 1–47 Author chain X； PDBConstruct 1–47； UniProt 1–47 Author chain Z； PDBConstruct 1–47； UniProt 1–47

High-potential iron-sulfur protein

OrganismNot specified

UniProt P80176

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 37	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） HEME C × 4 CALCIUM ION × 17 GLYCEROL × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 1 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 10 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 5 SULFATE ION × 1 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 CARDIOLIPIN × 10 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 DODECYL-BETA-D-MALTOSIDE × 2 IRON/SULFUR CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HIP_THETI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain b； PDBConstruct 1–83； UniProt 1–83

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7c52
Deposition date deposition_date	2020-05-18
Structure title title	Co-crystal structure of a photosynthetic LH1-RC in complex with electron donor HiPIP
Keywords keywords	LH1-RC, HiPIP, purple bacteria, electron transfer, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7c52__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7c52__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7c52__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.72 Å
Rg (electron density)	44.49 Å
Total Rg	45.02 Å
Atom count	27348
Residues	2809
Excluded volume	510850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7c52__assembly_1__model_1`	37-meric （37）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	Photosynthetic reaction center cytochrome c subunit
Molecular weight formula_weight	34409.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	27405

CEGPPPGTEQIGYRGVGMENYYNKRQRALSIQANQPVESLPAADSTGPKASEVYQNVQVLKDLSVGEFTRTMVAVTTWVSPKEGCNYCHVPGNWASDDIYTKVVSRRMFELVRAANSDWKAHVAETGVTCYTCHRGNPVPKYAWVTDPGPKYPSGLKPTGQNYGSKTVAYASLPFDPLTPFLDQANEIRITGNAALAGSNPASLKQAEWTFGLMMNISDSLGVGCTFCHNTRAFNDWTQSTPKRTTAWYAIRHVRDINQNYIWPLNDVLPASRKGPYGDPLRVSCMTCHQAVNKPLYGAQMAKDYPGLYKT

Entity 2 Entity 2 polymer

Description description	Photosynthetic reaction center L subunit
Molecular weight formula_weight	31520.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAMLSFEKKYRVRGGTLIGGDLFDFWVGPFYVGFFGVVGFCFTLLGVLLIVWGATIGPTGPTSDLQTYNLWRISIAPPDLSYGLRMAPLTEGGLWQIITICAAGAFISWALREVEICRKLGIGFHVPFAFSFAIGAYLVLVFVRPLLMGAWGHGFPYGILSHLDWVSNVGYQFLHFHYNPAHMLAISFFFTNCLALSMHGSLILSVTNPQKGEPVKTSEHENTFFRDIVGYSIGALAIHRLGLFLALSAAFWSAVCILISGPFWTRGWPEWWNWWLELPLW

Entity 3 Entity 3 polymer

Description description	Photosynthetic reaction center M subunit
Molecular weight formula_weight	36605.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MPEYQNIFTAVQVRAPAYPGVPLPKGNLPRIGRPIFSYWLGKIGDAQIGPIYLGLTGTLSIFFGLVAISIIGFNMLASVHWDVFQFLKHFFWLGLEPPPPQYGLRIPPLSEGGWWLMAGLFLTLSILLWWVRTYKRAEALGMSQHLSWAFAAAIFFYLVLGFIRPVMMGSWAKAVPFGIFPHLDWTAAFSIRYGNLYYNPFHMLSIAFLYGSALLFAMHGATILSVSRFGGDREIDQITHRGTAAERAALFWRWTMGFNVTMESIHRWAWWCAVLTVITAGIGILLSGTVVDNWYLWAVKHGMAPAYPEVVTAVNPYETAAEVMQ

Entity 4 Entity 4 polymer

Description description	Photosynthetic reaction center H subunit
Molecular weight formula_weight	28213.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSAGITHYIDAAQITIWAFWLFFFGLIIYLRREDKREGYPLDSDRTERSGGRVKVVGFPDLPDPKTFVLPHNGGTVVAPRVEAPVAVNATPFSPAPGSPLVPNGDPMLSGFGPAASPDRPKHCDLTFEGLPKIVPMRVAKEFSIAEGDPDPRGMTVVGLDGEVAGTVSDVWVDRSEPQIRYLEVEVAANKKKVLLPIGFSRFDKKARKVKVDAIKAAHFANVPTLSNPDQVTLYEEDKVCAYYAGGKLYATAERAGPLL

Entity 5 Entity 5 polymer

Description description	LH1 alpha polypeptide
Molecular weight formula_weight	7034.4 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,F,I,K,O,Q,S,U,W,Y,1,3,5,7,9

MFTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPVSYQALGKK

Entity 6 Entity 6 polymer

Description description	LH1 beta polypeptide
Molecular weight formula_weight	5534.5 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,G,J,N,P,R,T,V,X,Z,2,4,6,8,0

MAEQKSLTGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL

Entity 7 Entity 7 polymer

Description description	High-potential iron-sulfur protein
Molecular weight formula_weight	8793.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

AAPANAVTADDPTAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQANVGEGDWKGCQLFPGKLINVNGWCASWTLKAG

Entity 8 Entity 8 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 9 Entity 9 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 10 Entity 10 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 non-polymer

Description description	(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE
Molecular weight formula_weight	749.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 13 Entity 13 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	36

Entity 14 Entity 14 non-polymer

Description description	BACTERIOPHEOPHYTIN A
Molecular weight formula_weight	889.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	Ubiquinone-8
Molecular weight formula_weight	727.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 16 Entity 16 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	MENAQUINONE 8
Molecular weight formula_weight	717.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	SPIRILLOXANTHIN
Molecular weight formula_weight	596.9 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 20 Entity 20 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 21 Entity 21 non-polymer

Description description	DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 22 Entity 22 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 45 domains

SCOP 2.08 (36 domains)

Domain ID domain_id	d7c520_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c521_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c522_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c523_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c524_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c525_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c526_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c527_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c528_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c529_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52b_
Class class	g — Small proteins
Fold Fold fold	g.35 — HIPIP (high potential iron protein)
Superfamily Superfamily superfamily	g.35.1 — HIPIP (high potential iron protein)
Family Family family	g.35.1.1 — HIPIP (high potential iron protein)

Domain ID domain_id	d7c52c_
Class class	a — All alpha proteins
Fold Fold fold	a.138 — Multiheme cytochromes
Superfamily Superfamily superfamily	a.138.1 — Multiheme cytochromes
Family Family family	a.138.1.2 — Photosynthetic reaction centre (cytochrome subunit)

Domain ID domain_id	d7c52d_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52e_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52g_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52h1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.10 — Photosystem II reaction centre subunit H, transmembrane region
Family Family family	f.23.10.0 — automated matches

Domain ID domain_id	d7c52h2
Class class	b — All beta proteins
Fold Fold fold	b.41 — PRC-barrel domain
Superfamily Superfamily superfamily	b.41.1 — PRC-barrel domain
Family Family family	b.41.1.1 — Photosynthetic reaction centre, H-chain, cytoplasmic domain

Domain ID domain_id	d7c52i_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52j_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52k_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52m_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d7c52n_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52o_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52p_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52q_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52r_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52s_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52t_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52u_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52v_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52w_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52x_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52y_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d7c52z_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

CATH v4.4 (9 domains)

Domain ID domain_id	7c52101
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	7c52501
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	7c52D01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	7c52H01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	50 — Photosynthetic Reaction Center; Chain H, domain 2
Homologous superfamily homologous superfamily	10 — Photosynthetic Reaction Center, subunit H, domain 2

Domain ID domain_id	7c52I01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	7c52K01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	7c52O01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	7c52U01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	7c52W01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

▶

Unit-cell length a length_a	96.435 Å
Unit-cell length b length_b	183.335 Å
Unit-cell length c length_c	123.857 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	112.58 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	2.890 Å
Low-resolution limit resolution_low	29.990 Å
R factor r_factor	0.2203
R_work r_work	0.2188
R_free r_free	0.2477

Co-crystal structure of a photosynthetic LH1-RC in complex with electron donor HiPIP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center L subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center M subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center H subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LH1 alpha polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LH1 beta polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

High-potential iron-sulfur protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7c52__assembly_1__model_1

7c52__assembly_1__model_1 | I(q)

7c52__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer