SAXSdb — 4ype

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone-lysine N-methyltransferase ASH1L

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 2074–2293	Fragment：SET domain (UNP residues 2074-2293) Mutation：H2193F	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mM Tris	Resolution 2.20 Å R-free 0.263
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 2074–2293	Fragment：SET domain (UNP residues 2074-2293) Mutation：H2193F	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mM Tris	Resolution 2.20 Å R-free 0.263

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4YPE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3MQM Crystal Structure of the Bromodomain of human ASH1L Deposited 2010-04-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2438–2564（127 aa） Fragment：BROMODOMAIN of human ASH1L (UNP RESIDUES 2438:2564)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.15M NaNO3 20% PEG3350 10% EtGly, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.54 Å R-free 0.259
3MQM Crystal Structure of the Bromodomain of human ASH1L Deposited 2010-04-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2438–2564（127 aa） Fragment：BROMODOMAIN of human ASH1L (UNP RESIDUES 2438:2564)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.15M NaNO3 20% PEG3350 10% EtGly, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.54 Å R-free 0.259
3MQM Crystal Structure of the Bromodomain of human ASH1L Deposited 2010-04-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2438–2564（127 aa） Fragment：BROMODOMAIN of human ASH1L (UNP RESIDUES 2438:2564) Chain B 2438–2564（127 aa） Fragment：BROMODOMAIN of human ASH1L (UNP RESIDUES 2438:2564)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.15M NaNO3 20% PEG3350 10% EtGly, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.54 Å R-free 0.259
3OPE Structural Basis of Auto-inhibitory mechanism of Histone methyltransferase Deposited 2010-08-31	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2074–2293（220 aa） Fragment：SET domain (UNP RESIDUES 2074-2293)	Not recorded	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；Bistrisprofane, PEG, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.90 Å R-free 0.299
3OPE Structural Basis of Auto-inhibitory mechanism of Histone methyltransferase Deposited 2010-08-31	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2074–2293（220 aa） Fragment：SET domain (UNP RESIDUES 2074-2293)	Not recorded	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；Bistrisprofane, PEG, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.90 Å R-free 0.299
4YNM ASH1L wild-type SET domain in complex with S-adenosyl methionine (SAM) Deposited 2015-03-10	Different mutation/modification Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Not recorded	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mM Tris	Resolution 2.19 Å R-free 0.278
4YNM ASH1L wild-type SET domain in complex with S-adenosyl methionine (SAM) Deposited 2015-03-10	Different mutation/modification Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Not recorded	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mM Tris	Resolution 2.19 Å R-free 0.278
4YNP ASH1L SET domain S2259M mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-10	Different mutation/modification Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：S2259M	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mM Tris	Resolution 2.90 Å R-free 0.319
4YNP ASH1L SET domain S2259M mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-10	Different mutation/modification Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：S2259M	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mM Tris	Resolution 2.90 Å R-free 0.319
4YPA ASH1L SET domain Q2265A mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-12	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：Q2265A	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；PEG 4000, magnesium chloride, Tris	Resolution 2.30 Å R-free 0.303
4YPA ASH1L SET domain Q2265A mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-12	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：Q2265A	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；PEG 4000, magnesium chloride, Tris	Resolution 2.30 Å R-free 0.303
4YPA ASH1L SET domain Q2265A mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-12	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：Q2265A	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；PEG 4000, magnesium chloride, Tris	Resolution 2.30 Å R-free 0.303
4YPA ASH1L SET domain Q2265A mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-12	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：Q2265A	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；PEG 4000, magnesium chloride, Tris	Resolution 2.30 Å R-free 0.303
4YPU ASH1L SET domain K2264L mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-13	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：K2264L	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mm Tris	Resolution 2.60 Å R-free 0.305
4YPU ASH1L SET domain K2264L mutant in complex with S-adenosyl methionine (SAM) Deposited 2015-03-13	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2074–2293（220 aa） Fragment：SET domain (UNP residues 2074-2293)	Mutation：K2264L	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG 3350, 20 mm Tris	Resolution 2.60 Å R-free 0.305
6AGO Crystal structure of MRG15-ASH1L Histone methyltransferase complex Deposited 2018-08-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2039–2293（255 aa）	Not recorded	SAM S-ADENOSYLMETHIONINE × 1 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；295 K；Ammonium Acetate	Resolution 3.10 Å R-free 0.272
6AGO Crystal structure of MRG15-ASH1L Histone methyltransferase complex Deposited 2018-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2039–2293（255 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；295 K；Ammonium Acetate	Resolution 3.10 Å R-free 0.272
6INE Crystal Structure of human ASH1L-MRG15 complex Deposited 2018-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2026–2288（263 aa）	Not recorded	ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.1 M Tris-HCl pH 8.5, 20 % PEG 6000, 0.2 M Trimethylamine-N-oxide	Resolution 2.60 Å R-free 0.237
6WZW Ash1L SET domain in complex with AS-85 Deposited 2020-05-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2074–2293（220 aa）	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SAM S-ADENOSYLMETHIONINE × 1 ZN ZINC ION × 3 UG7 N-{[3-(3-carbamothioylphenyl)-1-{1-[(trifluoromethyl)sulfonyl]piperidin-4-yl}-1H-indol-6-yl]methyl}azetidine-3-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；290 K；0.1 M HEPES pH 7.5, 30% PEG3350	Resolution 1.69 Å R-free 0.206
6X0P Ash1L SET domain Q2265A mutant in complex with AS-5 Deposited 2020-05-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2074–2293（220 aa）	Mutation：Q2265A	UK7 3-[6-(aminomethyl)-1-(2-hydroxyethyl)-1H-indol-3-yl]benzene-1-carbothioamide × 1 ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；0.1 M Tris pH 8.5, 0.2 M MgCl2, 30% PEG4000	Resolution 1.69 Å R-free 0.213
6X0P Ash1L SET domain Q2265A mutant in complex with AS-5 Deposited 2020-05-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2074–2293（220 aa）	Mutation：Q2265A	UK7 3-[6-(aminomethyl)-1-(2-hydroxyethyl)-1H-indol-3-yl]benzene-1-carbothioamide × 1 ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；0.1 M Tris pH 8.5, 0.2 M MgCl2, 30% PEG4000	Resolution 1.69 Å R-free 0.213
6X0P Ash1L SET domain Q2265A mutant in complex with AS-5 Deposited 2020-05-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2074–2293（220 aa）	Mutation：Q2265A	UK7 3-[6-(aminomethyl)-1-(2-hydroxyethyl)-1H-indol-3-yl]benzene-1-carbothioamide × 1 ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；0.1 M Tris pH 8.5, 0.2 M MgCl2, 30% PEG4000	Resolution 1.69 Å R-free 0.213
6X0P Ash1L SET domain Q2265A mutant in complex with AS-5 Deposited 2020-05-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2074–2293（220 aa）	Mutation：Q2265A	UK7 3-[6-(aminomethyl)-1-(2-hydroxyethyl)-1H-indol-3-yl]benzene-1-carbothioamide × 1 ZN ZINC ION × 3 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；0.1 M Tris pH 8.5, 0.2 M MgCl2, 30% PEG4000	Resolution 1.69 Å R-free 0.213
7Y0I Solution structures of ASH1L PHD domain in complex with H3K4me2 peptide Deposited 2022-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2584–2635（52 aa）	Not recorded	ZN ZINC ION × 2	SOLUTION NMR NMR measurement conditions pH 7.2；298 K；Ionic strength (raw mmCIF value) null；Pressure 1 NMR sample composition 50 mM sodium phosphate, 100 mM sodium chloride, 100 uM ZINC ION, 2.0 mM [U-100% 2H] DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 50 mM sodium phosphate, 100 mM sodium chloride, 100 uM ZINC ION, 2.0 mM [U-100% 2H] DTT, 100% D2O \| 100% D2O	Resolution not provided
8VLD Crystal structure of Ash1L PHD finger in complex with histone H3K4me2 Deposited 2024-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2584–2636（53 aa） Chain B 2584–2636（53 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；1.6 M sodium citrate pH 6.5	Resolution 1.92 Å R-free 0.249
8VLF Crystal structure of Ash1L PHD finger in complex with histone H3K4me3 Deposited 2024-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2584–2636（53 aa） Chain B 2584–2636（53 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；1.6 M sodium citrate pH 6.5	Resolution 1.34 Å R-free 0.188
8VLH Crystal structure of Ash1L PHD-BAH domains Deposited 2024-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2584–2839（256 aa） Chain B 2584–2839（256 aa）	Not recorded	ZN ZINC ION × 4 SR STRONTIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1 M Bis-Tris propane pH 10, 0.25 M strontium chloride, 0.01 M ammonium sulfate, and 25% PEG 8000	Resolution 2.40 Å R-free 0.284

14 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ASH1L_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–226； UniProt 2074–2293 Author chain B； PDBConstruct 7–226； UniProt 2074–2293

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ype
Deposition date deposition_date	2015-03-12
Structure title title	ASH1L SET domain H2193F mutant in complex with S-adenosyl methionine (SAM)
Keywords keywords	histone methylation, SET domain, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.96 Å
Radius of gyration Rg (electron density) rg_electron	22.83 Å
Forward intensity I(0) i0	47566700.00
Molecular weight molecular_weight	49731.0 kDa
Excluded volume excluded_volume	60567 Å³
Envelope volume envelope_volume	74880 Å³
Hydration-shell volume shell_volume	26928 Å³
Envelope diameter envelope_diameter	73.3 Å
Shell Rg shell_rg	30.07 Å
Envelope Rg envelope_rg	22.87 Å
Shape Rg shape_rg	22.79 Å
Total Rg total_rg	23.77 Å
Total atoms total_atoms	3446
Residues n_residues	419
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	72.5 Å
Rg (real space) rg_real	23.79 Å
Rg uncertainty (real space) rg_real_error	0.47 Å
I(0) (real space) i0_real	4.7570e+07
I(0) uncertainty (real space) i0_real_error	6.0910e+05
Rg (reciprocal space) rg_reciprocal	23.83 Å
I(0) (reciprocal space) i0_reciprocal	47570000.0000
Solution quality estimate total_estimate	0.9088
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	32.8 Å
Skewness Skewness skewness	0.089
Kurtosis Kurtosis kurtosis	-0.507
Angular range angular_range	— – 0.3300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4254000.0000
Real-space data points n_real_points	65
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.949; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.991; Smooth: 0.976

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Histone-lysine N-methyltransferase ASH1L
Molecular weight formula_weight	26025.5 kDa
EC 编号 ec_number	2.1.1.43
Mutation mutation	H2193F
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3572

GAMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDFYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 non-polymer

Description description	S-ADENOSYLMETHIONINE
Molecular weight formula_weight	398.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	107

▼

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	4ypeA00
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	270 — Beta-clip-like
Homologous superfamily homologous superfamily	10 — SET domain

Domain ID domain_id	4ypeB00
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	270 — Beta-clip-like
Homologous superfamily homologous superfamily	10 — SET domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	58.838 Å
Unit-cell length b length_b	58.838 Å
Unit-cell length c length_c	232.152 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	42.560 Å
R factor r_factor	0.2188
R_work r_work	0.2165
R_free r_free	0.2625

fit	/app/data/saxs_computation/yp/4ype/4ype.fit
pddf	/app/data/pr_computation/yp/4ype/4ype.pr.out
profile	/app/data/saxs_computation/yp/4ype/4ype.dat

ASH1L SET domain H2193F mutant in complex with S-adenosyl methionine (SAM)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone-lysine N-methyltransferase ASH1L

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction