4zia

Crystal Structure of STAT3 N-terminal domain

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Signal transducer and activator of transcription 3

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	NICKEL (II) ION × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	FORMIC ACID × 1 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STAT3_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–129； UniProt 3–127 Author chain B； PDBConstruct 5–129； UniProt 3–127 Author chain C； PDBConstruct 5–129； UniProt 3–127 Author chain D； PDBConstruct 5–129； UniProt 3–127 Author chain E； PDBConstruct 5–129； UniProt 3–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4zia
Deposition date deposition_date	2015-04-28
Structure title title	Crystal Structure of STAT3 N-terminal domain
Keywords keywords	STAT N-terminal domain, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4zia__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4zia__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4zia__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.20 Å
Rg (electron density)	20.09 Å
Total Rg	21.04 Å
Atom count	2093
Residues	248
Excluded volume	36934 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4zia__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4zia__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4zia__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Signal transducer and activator of transcription 3
Molecular weight formula_weight	15215.0 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	5149

GPGSQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGG

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	NICKEL (II) ION
Molecular weight formula_weight	58.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	FORMIC ACID
Molecular weight formula_weight	46.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	63

▼

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (10 domains)

Domain ID domain_id	d4ziaa1
Class class	a — All alpha proteins
Fold Fold fold	a.90 — Transcription factor STAT-4 N-domain
Superfamily Superfamily superfamily	a.90.1 — Transcription factor STAT-4 N-domain
Family Family family	a.90.1.0 — automated matches

Domain ID domain_id	d4ziaa2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4ziab1
Class class	a — All alpha proteins
Fold Fold fold	a.90 — Transcription factor STAT-4 N-domain
Superfamily Superfamily superfamily	a.90.1 — Transcription factor STAT-4 N-domain
Family Family family	a.90.1.0 — automated matches

Domain ID domain_id	d4ziab2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4ziac1
Class class	a — All alpha proteins
Fold Fold fold	a.90 — Transcription factor STAT-4 N-domain
Superfamily Superfamily superfamily	a.90.1 — Transcription factor STAT-4 N-domain
Family Family family	a.90.1.0 — automated matches

Domain ID domain_id	d4ziac2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4ziad1
Class class	a — All alpha proteins
Fold Fold fold	a.90 — Transcription factor STAT-4 N-domain
Superfamily Superfamily superfamily	a.90.1 — Transcription factor STAT-4 N-domain
Family Family family	a.90.1.0 — automated matches

Domain ID domain_id	d4ziad2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4ziae1
Class class	a — All alpha proteins
Fold Fold fold	a.90 — Transcription factor STAT-4 N-domain
Superfamily Superfamily superfamily	a.90.1 — Transcription factor STAT-4 N-domain
Family Family family	a.90.1.0 — automated matches

Domain ID domain_id	d4ziae2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (5 domains)

Domain ID domain_id	4ziaA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	532 — Transcription Factor, Stat-4
Homologous superfamily homologous superfamily	10 — STAT transcription factor, N-terminal domain

Domain ID domain_id	4ziaB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	532 — Transcription Factor, Stat-4
Homologous superfamily homologous superfamily	10 — STAT transcription factor, N-terminal domain

Domain ID domain_id	4ziaC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	532 — Transcription Factor, Stat-4
Homologous superfamily homologous superfamily	10 — STAT transcription factor, N-terminal domain

Domain ID domain_id	4ziaD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	532 — Transcription Factor, Stat-4
Homologous superfamily homologous superfamily	10 — STAT transcription factor, N-terminal domain

Domain ID domain_id	4ziaE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	532 — Transcription Factor, Stat-4
Homologous superfamily homologous superfamily	10 — STAT transcription factor, N-terminal domain

▶

Unit-cell length a length_a	109.012 Å
Unit-cell length b length_b	109.012 Å
Unit-cell length c length_c	154.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	40

Space group space_group	P 41 2 2
Space-group number int_tables_number	91
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	—
R_work r_work	0.2362
R_free r_free	0.2701

Crystal Structure of STAT3 N-terminal domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Signal transducer and activator of transcription 3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4zia__assembly_1__model_1

4zia__assembly_1__model_1 | I(q)

4zia__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (10 domains)

CATH v4.4 (5 domains)

7. Citations (1)

Crystal Structure of STAT3 N-terminal domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Signal transducer and activator of transcription 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4zia__assembly_1__model_1

4zia__assembly_1__model_1 | I(q)

4zia__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (10 domains)

CATH v4.4 (5 domains)

7. Citations (1)