SAXSdb — 5ajk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HOMOLOG OF VACCINIA VIRUS CDS F1L

VARIOLA VIRUS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	BCL-2 HOMOLOGOUS ANTAGONIST/KILLER × 2 （Q16611） CHLORIDE ION × 2 ACETATE ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	BCL-2 HOMOLOGOUS ANTAGONIST/KILLER × 2 （Q16611） ACETATE ION × 1 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	BCL-2 HOMOLOGOUS ANTAGONIST/KILLER × 2 （Q16611） ACETATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q85365_VARV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–168； UniProt 39–201 Author chain C； PDBConstruct 6–168； UniProt 39–201 Author chain E； PDBConstruct 6–168； UniProt 39–201 Author chain G； PDBConstruct 6–168； UniProt 39–201 Author chain I； PDBConstruct 6–168； UniProt 39–201 Author chain K； PDBConstruct 6–168； UniProt 39–201

BCL-2 HOMOLOGOUS ANTAGONIST/KILLER

HOMO SAPIENS

UniProt Q16611

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	HOMOLOG OF VACCINIA VIRUS CDS F1L × 2 （Q85365） CHLORIDE ION × 2 ACETATE ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	HOMOLOG OF VACCINIA VIRUS CDS F1L × 2 （Q85365） ACETATE ION × 1 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	HOMOLOG OF VACCINIA VIRUS CDS F1L × 2 （Q85365） ACETATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BAK_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–26； UniProt 67–92 Author chain D； PDBConstruct 1–26； UniProt 67–92 Author chain F； PDBConstruct 1–26； UniProt 67–92 Author chain H； PDBConstruct 1–26； UniProt 67–92 Author chain J； PDBConstruct 1–26； UniProt 67–92 Author chain L； PDBConstruct 1–26； UniProt 67–92

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5ajk
Deposition date deposition_date	2015-02-25
Structure title title	Crystal structure of variola virus virulence factor F1L in complex with human Bak BH3 domain
Keywords keywords	BCL-2, APOPTOSIS, POXVIRUS, BID; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5ajk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5ajk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5ajk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.57 Å
Rg (electron density)	21.47 Å
Total Rg	22.20 Å
Atom count	5332
Residues	333
Excluded volume	47951 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5ajk__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5ajk__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5ajk__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	HOMOLOG OF VACCINIA VIRUS CDS F1L
Molecular weight formula_weight	19652.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K
Atom count atom_count	15824

GPLGSKASNNDDHNYVYPLPENMVYRFNKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLPTKTRSYIDIINMYCDKVNNDYNRDMNIMYDMASTESFTVYDINNEVNTILMDNKGLGVRLATISFITELGKRCMNPVETIKMFTLLSHTICDDCFIDYITDIS

Source Source

Source organism organism	VARIOLA VIRUS
Common name common_name	SMALLPOX
NCBI taxonomy ID ncbi_taxonomy_id	10255
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	BCL-2 HOMOLOGOUS ANTAGONIST/KILLER
Molecular weight formula_weight	2882.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L

PSSTMGQVGRQLAIIGDDINRRYDSE

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	98

▶

Unit-cell length a length_a	124.774 Å
Unit-cell length b length_b	68.762 Å
Unit-cell length c length_c	171.598 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	109.43 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	I 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.550 Å
Low-resolution limit resolution_low	39.702 Å
R factor r_factor	0.1990
R_work r_work	0.1968
R_free r_free	0.2405

Crystal structure of variola virus virulence factor F1L in complex with human Bak BH3 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

HOMOLOG OF VACCINIA VIRUS CDS F1L

State in the Current Structure

Other States of the Same Protein in the Database

BCL-2 HOMOLOGOUS ANTAGONIST/KILLER

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ajk__assembly_1__model_1

5ajk__assembly_1__model_1 | I(q)

5ajk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of variola virus virulence factor F1L in complex with human Bak BH3 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

HOMOLOG OF VACCINIA VIRUS CDS F1L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BCL-2 HOMOLOGOUS ANTAGONIST/KILLER

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ajk__assembly_1__model_1

5ajk__assembly_1__model_1 | I(q)

5ajk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)