SAXSdb — 5ajj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HOMOLOG OF VACCINIA VIRUS CDS F1L PUTATIVE

VARIOLA VIRUS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 39–201	Fragment：UNP RESIDUES 39-201	BH3-INTERACTING DOMAIN DEATH AGONIST × 2 （P55957） GOL GLYCEROL × 2 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6.5；1.8 M SODIUM ACETATE AND 0.1 M HEPES PH 6.5	Resolution 1.75 Å R-free 0.208

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5AJJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5AJK Crystal structure of variola virus virulence factor F1L in complex with human Bak BH3 domain Deposited 2015-02-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 39–201（163 aa） Fragment：RESIDUES 39-201 Chain C 39–201（163 aa） Fragment：RESIDUES 39-201	Not recorded	CL CHLORIDE ION × 2 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.2；1.7 M MGSO4, 0.1 M NA-ACETATE PH 5.2	Resolution 2.55 Å R-free 0.240
5AJK Crystal structure of variola virus virulence factor F1L in complex with human Bak BH3 domain Deposited 2015-02-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 39–201（163 aa） Fragment：RESIDUES 39-201 Chain K 39–201（163 aa） Fragment：RESIDUES 39-201	Not recorded	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.2；1.7 M MGSO4, 0.1 M NA-ACETATE PH 5.2	Resolution 2.55 Å R-free 0.240
5AJK Crystal structure of variola virus virulence factor F1L in complex with human Bak BH3 domain Deposited 2015-02-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 39–201（163 aa） Fragment：RESIDUES 39-201 Chain I 39–201（163 aa） Fragment：RESIDUES 39-201	Not recorded	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.2；1.7 M MGSO4, 0.1 M NA-ACETATE PH 5.2	Resolution 2.55 Å R-free 0.240

1 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q85365_VARV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–168； UniProt 39–201

BH3-INTERACTING DOMAIN DEATH AGONIST

HOMO SAPIENS

UniProt P55957

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 79–112	Fragment：UNP RESIDUES 79-112	HOMOLOG OF VACCINIA VIRUS CDS F1L PUTATIVE × 2 （Q85365） GOL GLYCEROL × 2 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6.5；1.8 M SODIUM ACETATE AND 0.1 M HEPES PH 6.5	Resolution 1.75 Å R-free 0.208

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5AJJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1ZY3 Structural model of complex of Bcl-w protein with Bid BH3-peptide Deposited 2005-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 82–101（20 aa）	Mutation：R203K	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；303 K；Ionic strength (raw mmCIF value) 10 mM NaCl；Pressure 1 NMR sample composition 0.7 mM Bcl-w U-15N,13C, 0.7 mM Bid BH3-peptide, 20 mM phosphate buffer, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.7 mM Bcl-w U-15N, 0.7 mM Bid BH3-peptide, 20 mM phosphate buffer, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.7 mM Bid BH3-peptide U-15N, 0.7 mM Bcl-w, 20 mM phosphate buffer, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2BID HUMAN PRO-APOPTOTIC PROTEIN BID Deposited 1999-01-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–195（195 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Pressure 1	Resolution not provided
2KBW Solution Structure of human Mcl-1 complexed with human Bid_BH3 peptide Deposited 2008-12-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 76–106（31 aa） Fragment：BH3 motif, residues 76-106	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 20；Pressure ambient NMR sample composition 0.5 mM [U-95% 15N] Mcl-1-1, 0.5 mM Bid_BH3-2, 20 mM HEPES-3, 1 mM DTT-4, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM Mcl-1-5, 0.5 mM [U-95% 15N] Bid_BH3-6, 20 mM HEPES-7, 1 mM DTT-8, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-95% 13C; U-95% 15N] Mcl-1-9, 0.5 mM Bid_BH3-10, 20 mM HEPES-11, 1 mM DTT-12, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-95% 13C; U-95% 15N] Mcl-1-13, 0.5 mM Bid_BH3-14, 20 mM HEPES-15, 1 mM DTT-16, 100 % [U-100% 2H] D2O-17, 100% D2O \| 100% D2O NMR sample composition 0.5 mM Mcl-1-18, 0.5 mM [U-95% 13C; U-95% 15N] Bid_BH3-19, 20 mM HEPES-20, 1 mM DTT-21, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM Mcl-1-22, 0.5 mM [U-95% 13C; U-95% 15N] Bid_BH3-23, 20 mM HEPES-24, 1 mM DTT-25, 100 % [U-100% 2H] D2O-26, 100% D2O \| 100% D2O NMR sample composition 0.4 mM [U-95% 15N] Mcl-1-27, 0.4 mM Bid_BH3-28, 20 mM HEPES-29, 1 mM DTT-30, 6 mg/mL Pf1 phage-31, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.4 mM Mcl-1-32, 0.4 mM [U-95% 15N] Bid_BH3-33, 20 mM HEPES-34, 1 mM DTT-35, 8 mg/mL Pf1 phage-36, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2M5I NMR structures of human apoptotic protein tBid in LPPG micelle Deposited 2013-02-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 61–195（135 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.6；318 K；Ionic strength (raw mmCIF value) 0.1；Pressure ambient NMR sample composition 0.5 mM [U-15N] tBid in LPPG micelle, 0.8 mM [U-13C; U-15N] tBid in LPPG micelle, 0.8 mM [U-100% 15N; U-80% 2H] tBid in LPPG micelle, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1.0 mM [U-100% 13C; U-100% 15N] tBid in LPPG micelle, 100% D2O \| 100% D2O	Resolution not provided
4BD2 Bax domain swapped dimer in complex with BidBH3 Deposited 2012-10-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 76–109（34 aa） Fragment：RESIDUES 76-109	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 1.4 M SODIUM CITRATE, 0.1 M SODIUM CACODYLATE PH 5.75	Resolution 2.21 Å R-free 0.227
4QVE Crystal structure of Bcl-xL in complex with BID BH3 domain Deposited 2014-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 76–109（34 aa） Fragment：BID BH3, UNP RESIDUES 76-109	Not recorded	IMD IMIDAZOLE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；291 K；2.0M Ammonium Sulphate, 0.2M Lithium Sulphate, 0.1M CAPS pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.05 Å R-free 0.224
4ZEQ Crystal Structure of human BFL-1 in complex with tBid BH3 peptide, Northeast Structural Genomics Consortium Target HX9247 Deposited 2015-04-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 125–150（26 aa） Fragment：UNP Residues 125-150	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；295 K；Sodium Malonate	Resolution 1.80 Å R-free 0.239
4ZIG Crystal Structure of core/latch dimer of Bax in complex with BidBH3mini Deposited 2015-04-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 125–144（20 aa） Fragment：BH3 motif	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；Tri-sodium citrate, Sodium cacodylate	Resolution 2.20 Å R-free 0.229
4ZII Crystal Structure of core/latch dimer of BaxI66A in complex with BidBH3 Deposited 2015-04-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 122–155（34 aa） Fragment：BH3 motif	Not recorded	EDO 1,2-ETHANEDIOL × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；Tri-sodium citrate, sodium cacodylate	Resolution 2.19 Å R-free 0.223
7M5A Crystal Structure of human BAK in complex with W3W5_BID Deposited 2021-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 80–100（21 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；293 K；0.2 M Potassium Sodium tartrate, 20% PEG 3350	Resolution 1.50 Å R-free 0.219
7M5B Crystal Structure of human BAK in complex with M3W5_BID Deposited 2021-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 80–100（21 aa）	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；293 K；15% PEG 4000 0.2 M NaCl 0.1 MES 6.5	Resolution 1.85 Å R-free 0.205
7M5B Crystal Structure of human BAK in complex with M3W5_BID Deposited 2021-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 80–100（21 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；293 K；15% PEG 4000 0.2 M NaCl 0.1 MES 6.5	Resolution 1.85 Å R-free 0.205
7P33 Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide Deposited 2021-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 76–109（34 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.4M Ammonium phosphate mono basic	Resolution 2.79 Å R-free 0.274
7P33 Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide Deposited 2021-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 76–109（34 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.4M Ammonium phosphate mono basic	Resolution 2.79 Å R-free 0.274
7P33 Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide Deposited 2021-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 76–109（34 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.4M Ammonium phosphate mono basic	Resolution 2.79 Å R-free 0.274
7P33 Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide Deposited 2021-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 76–109（34 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.4M Ammonium phosphate mono basic	Resolution 2.79 Å R-free 0.274
7P33 Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide Deposited 2021-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 76–109（34 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.4M Ammonium phosphate mono basic	Resolution 2.79 Å R-free 0.274
7QTW Kaposi sarcoma associated herpes virus(KSHV) encoded apoptosis inhibitor, KsBcl-2 in complex with Bid BH3 Deposited 2022-01-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 76–109（34 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；293 K；0.1 M Sodium acetate pH 4.6 8% PEG 4000	Resolution 1.41 Å R-free 0.215

13 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BID_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–34； UniProt 79–112

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5ajj
Deposition date deposition_date	2015-02-25
Structure title title	Crystal structure of variola virus virulence factor F1L in complex with human Bid BH3 domain
Keywords keywords	VIRAL PROTEIN, BCL-2, APOPTOSIS, POXVIRUS, BID; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.61 Å
Radius of gyration Rg (electron density) rg_electron	17.52 Å
Forward intensity I(0) i0	7424870.00
Molecular weight molecular_weight	19418.0 kDa
Excluded volume excluded_volume	24136 Å³
Envelope volume envelope_volume	30246 Å³
Hydration-shell volume shell_volume	15102 Å³
Envelope diameter envelope_diameter	61.8 Å
Shell Rg shell_rg	22.90 Å
Envelope Rg envelope_rg	17.56 Å
Shape Rg shape_rg	17.53 Å
Total Rg total_rg	18.43 Å
Total atoms total_atoms	2682
Residues n_residues	167
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	62.4 Å
Rg (real space) rg_real	18.56 Å
Rg uncertainty (real space) rg_real_error	0.53 Å
I(0) (real space) i0_real	7.4250e+06
I(0) uncertainty (real space) i0_real_error	9.8410e+04
Rg (reciprocal space) rg_reciprocal	18.56 Å
I(0) (reciprocal space) i0_reciprocal	7425000.0000
Solution quality estimate total_estimate	0.7936
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	22.2 Å
Skewness Skewness skewness	0.227
Kurtosis Kurtosis kurtosis	-0.338
Angular range angular_range	— – 0.4250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	714000.0000
Real-space data points n_real_points	74
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.783; Stabil: 0.989; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	HOMOLOG OF VACCINIA VIRUS CDS F1L PUTATIVE
Molecular weight formula_weight	19652.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2806

GPLGSKASNNDDHNYVYPLPENMVYRFNKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLPTKTRSYIDIINMYCDKVNNDYNRDMNIMYDMASTESFTVYDINNEVNTMLLDNKGLGVRLATISFITELGKRCMNPVETIKMFTLLSHTICDDCFIDYITDIS

来源 Source

来源生物 organism	VARIOLA VIRUS
通用名 common_name	SMALLPOX
NCBI Class编号 ncbi_taxonomy_id	10255
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	BH3-INTERACTING DOMAIN DEATH AGONIST
Molecular weight formula_weight	3702.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

QEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQ

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	118

▶

8. Citations (1)

▶

Unit-cell length a length_a	52.094 Å
Unit-cell length b length_b	112.318 Å
Unit-cell length c length_c	117.178 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	F 2 2 2
Space-group number int_tables_number	22
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	43.828 Å
R factor r_factor	0.1689
R_work r_work	0.1668
R_free r_free	0.2083

fit	/app/data/saxs_computation/aj/5ajj/5ajj.fit
pddf	/app/data/pr_computation/aj/5ajj/5ajj.pr.out
profile	/app/data/saxs_computation/aj/5ajj/5ajj.dat

Crystal structure of variola virus virulence factor F1L in complex with human Bid BH3 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

HOMOLOG OF VACCINIA VIRUS CDS F1L PUTATIVE

State in the Current Structure

Other States of the Same Protein in the Database

BH3-INTERACTING DOMAIN DEATH AGONIST

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)